SecReT4
Protein ID: 253801057
T4SS name [ID]Tra_F [109]
Gene symboltraI
Locus tagpVir_83
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]83004..88295 [+]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDC5ZZM7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 2.9e-87, Aligned region: 14..294
TraI [PF07057], Evalue: 1.4e-58, Aligned region: 1441..1567
AAA_30 [PF13604], Evalue: 2.5e-42, Aligned region: 975..1163
AAA_19 [PF13245], Evalue: 1.3e-05, Aligned region: 989..1054
Protein Sequence: 1763 a.a.     [Download]
>gi|253801057|ref|YP_003034058.1| conjugal transfer nickase/helicase TraI [Escherichia coli Vir68]
MSKGYTFMMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGKLPDG
ADLSRMQDGSNKHRPGYDLTFSAPKSVSVMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSET
VLTGNLVMALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREK
LKEQVEALGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVR
MAEWMQTLKETGFDIRAYRDAADQRAETRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLART
VGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSV
PRTAGYSDAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLS
GELITGRRQLQEGMAFTPGNTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDA
GVNTYRWQGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGV
LGRPEITMTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSNSLTLRDAQGETQVV
RISSLDSSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVSDS
PFMALKLENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSF
TVVSEQIKARAGETLLETAISLQKTGLHTPAQQAIHLALPVVESKNLAFSMVDLLTEAKSFAAEGTSFTE
LGGEINAQIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQ
RAATRMILETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTL
ASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFR
LQQTRSAADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQ
EAKLAEAQQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDALEKAGE
LGKEQVMVPVLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISKDDGLITLEDAEGNTRLISPRE
AVAEGVTLYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVFGDSVTLSDGQQTRVIRPGQERAEQH
IDLAYAITAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDDRQGWTDAINNAVQK
GTAHDVFEPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFD
RNGKSAGIWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGV
VVRIAGEGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMA
ENKPDLPDGRTEQAVREIAGQERERAVTSEREAALPESVLREPQREREAVREVVRENLLQERLQQMERDM
VRDLQKEKTLGGD
 
Nucleotide Sequence: 5292 bp     [Download]
>gi|253800975|ref|NC_012944.1|:83004-88295 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGTCAAAGGGATATACGTTTATGATGAGTATCGCGCAGGTCAGATCGGCCGGAAGTGCCGGTAACTATT
ATACCGACAAGGATAATTACTATGTGCTGGGCAGCATGGGAGAACGCTGGGCCGGCAGGGGGGCTGAACA
GCTGGGGCTGCAGGGCAGCGTCGATAAGGATGTTTTTACCCGTCTTCTGGAGGGGAAGCTGCCGGACGGA
GCGGATTTAAGCCGCATGCAGGATGGCAGTAATAAGCATCGTCCCGGCTACGACCTGACCTTCTCCGCCC
CCAAAAGTGTCTCCGTGATGGCCATGTTAGGCGGTGATAAACGTCTTATTGATGCACATAACCAGGCCGT
GGATTTTGCTGTCCGTCAGGTGGAGGCGCTGGCTTCCACACGGGTTATGACGGACGGACAGTCAGAAACG
GTGCTGACCGGTAATCTGGTGATGGCACTGTTTAACCACGACACCAGTCGCGATCAGGAACCACAGTTAC
ACACACATGCGGTAGTGGCCAATGTCACGCAGCATAACGGCGAGTGGAAGACATTGAGCAGTGACAAAGT
GGGGAAAACGGGGTTCATTGAGAATGTGTACGCTAATCAGATTGCCTTCGGCAGGCTCTACCGGGAAAAA
CTGAAAGAGCAGGTTGAGGCGCTGGGCTATGAAACGGAAGTGGTTGGTAAGCACGGTATGTGGGAGATGC
CGGGCGTACCGGTGGAGGCCTTCTCCGGACGCTCACAGGCTATCCGGGAGGCCGTCGGGGAAGACGCCTC
GCTGAAATCCCGGGATGTGGCGGCACTGGATACGCGAAAATCCAAACAGCACGTCGATCCTGAAGTCAGA
ATGGCTGAATGGATGCAGACGCTGAAGGAAACCGGGTTCGACATCCGGGCGTATCGTGACGCGGCGGACC
AACGGGCGGAGACCCGCACGCAGACGCCCGGACCCGCTTCACAGGACGGGCCGGATGTGCAGCAGGCGGT
GACACAGGCCATTGCCGGATTAAGTGAACGCAAAGTGCAGTTTACGTACACGGACGTGCTGGCCAGAACG
GTCGGCATACTGCCGCCGGAAAATGGTGTGATTGAACGGGCACGCGCCGGTATCGATGAGGCCATCAGCC
GTGAGCAGCTTATCCCCCTCGATCGTGAGAAGGGGCTGTTCACGTCCGGGATTCATGTGCTCGATGAGCT
GTCAGTCCGGGCACTCAGTCGTGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTC
CCCCGGACGGCCGGTTACAGCGATGCGGTCAGTGTTCTGGCACAGGATCGCCCGTCGCTGGCTATTGTGT
CCGGGCAGGGCGGTGCAGCCGGGCAGCGTGAGCGGGTGGCGGAGCTGGTCATGATGGCCCGGGAGCAGGG
GCGGGAGGTGCAGATTATCGCCGCTGACCGTCGCTCGCAGATGAACCTGAAGCAGGATGAACGGCTGTCC
GGTGAGCTGATAACCGGACGTCGTCAGCTGCAGGAGGGCATGGCCTTCACGCCGGGCAATACTGTTATCG
TTGACCAGGGCGAAAAACTCTCCCTGAAAGAGACGTTAACCCTGCTGGACGGTGCCGCACGTCATAACGT
ACAGGTCCTGATAACCGACAGCGGGCAGCGAACCGGTACAGGCAGTGCACTGATGGCCATGAAAGATGCC
GGGGTGAACACATATCGCTGGCAGGGGGGAGAACAGCGGCCGGCCACCATCATCAGTGAACCGGACCGTA
ATGTCCGCTATGCCCGGCTGGCAGGAGATTTTGCTGCCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCACA
GGTCAGCGGGGTACGGGAACAGGCCATACTGACACAGGCCATTCGCAGTGAGCTGAAAACACAGGGCGTG
CTCGGACGCCCGGAGATAACCATGACCGCCCTGTCGCCGGTCTGGCTGGACAGCCGGAGCCGTTATCTGC
GGGATATGTACCGTCCGGGGATGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTCATGACCGCTATGT
TATCGACCGGGTGACGGCGCAGAGTAACAGCCTGACCCTGCGGGATGCGCAGGGTGAAACGCAGGTGGTG
CGTATTTCCTCCCTGGACAGCAGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGC
GACTGAGGGTGACAGGGAAAATTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGGCATCCGT
CAGTGAAGATGCGATGACGGTTGTTGTGCCGGGGCGGGCTGAACCGGCCTCCCTGCCTGTGAGCGATTCA
CCATTCATGGCACTGAAGCTAGAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGCGACAGTGCGA
AGGTTTTTGCCTCCGTCACACAGATGGCAATGGACAACGCCACCCTGAACGGTCTGGCCCGCAGCGGTCG
TGATGTCCGGCTGTATTCCTCACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCCTCCTTT
ACGGTGGTTTCTGAGCAGATAAAGGCGCGTGCCGGTGAGACATTGCTGGAAACCGCTATCAGTCTGCAGA
AAACCGGGCTTCACACGCCGGCACAGCAGGCTATTCATCTGGCGCTTCCTGTGGTGGAAAGTAAAAACCT
GGCCTTCAGCATGGTGGACCTGCTGACAGAGGCGAAGTCGTTTGCTGCAGAAGGAACCAGTTTTACTGAA
CTGGGAGGGGAAATCAATGCGCAGATAAAACGCGGTGATTTACTGTATGTGGATGTGGCAAAAGGCTATG
GCACAGGCCTGCTGGTTTCCCGTGCGTCGTATGAGGCAGAAAAGAGCATTCTTCGCCATATTCTCGAAGG
TAAGGAGGCGGTCACGCCACTGATGGAGAGAGTACCTGGCGAACTCATGGAGACACTGACGTCGGGACAG
CGTGCCGCCACCCGTATGATACTGGAAACGTCCGACCGTTTCACGGTGGTACAGGGGTATGCCGGTGTGG
GTAAGACCACACAGTTCCGGGCGGTGATGTCAGCCGTGAACATGCTGCCGGAGAGTGAGCGTCCCCGTGT
CGTGGGGCTGGGGCCCACGCACCGTGCGGTCGGGGAGATGCGCAGCGCCGGCGTGGATGCACAGACACTG
GCGTCCTTTCTGCATGACACGCAGCTGCAGCAGCGCAGCGGAGAAACGCCGGATTTCAGCAACACGCTGT
TCCTGCTCGATGAGAGCTCAATGGTGGGCAATACCGACATGGCACGGGCATACGCCCTGATTGCGGCCGG
TGGCGGTCGTGCTGTGGCCAGCGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGT
CTCCAGCAGACGCGCAGTGCTGCCGATGTGGCCATCATGAAGGAGATTGTGCGTCAGACGCCGGAACTGC
GGGAGGCGGTATACAGCCTGATTAACCGGGATGTGGAAAGGGCACTGTCCGGTCTTGAGAGTGTGAAACC
GTCTCAGGTGCCACGTCAGGAGGGCGCATGGGCACCGGAGCACTCTGTGACGGAGTTCAGTCACAGCCAG
GAAGCGAAACTGGCAGAAGCGCAGCAGAAGGCGATGCTGAAAGGCGAGGCTTTCCCGGATGTCCCCATGA
CACTGTATGAAGCCATTGTCCGCGACTATACCGGCAGGACGCCGGAAGCACGGGAGCAGACGCTGATTGT
CACGCACCTGAATGAGGACCGGCGCGTGCTGAACAGCATGATTCATGATGCACTGGAAAAGGCCGGTGAG
CTGGGAAAAGAGCAGGTCATGGTGCCTGTCCTGAACACAGCGAATATACGCGACGGGGAGTTGCGTCGTC
TCTCCACCTGGGAGACTCATCGGGACGCACTAGCCCTGGTGGATAATGTGTATCACCGGATTGCCGGTAT
CAGTAAGGATGACGGGCTGATAACCCTGGAGGATGCGGAAGGTAACACGCGGCTGATTTCGCCCCGGGAG
GCGGTGGCTGAAGGTGTCACACTGTACACCCCGGACACCATCCGGGTGGGGACCGGTGACCGGATGCGCT
TCACGAAGAGTGACCGGGAGCGCGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCGGTTTTCGGTGA
CAGTGTCACGCTGTCGGACGGCCAGCAGACCCGGGTGATTCGCCCCGGCCAGGAGCGGGCAGAGCAACAT
ATTGACCTGGCCTATGCCATCACCGCCCACGGTGCGCAGGGGGCGAGTGAAACCTTTGCCATCGCGCTTG
AAGGCACGGAAGGTAACCGGAAACTGATGGCCGGCTTTGAGTCAGCCTACGTTGCCCTGTCGCGTATGAA
GCAGCATGTACAGGTGTACACCGATGACCGTCAGGGCTGGACGGATGCCATTAACAATGCCGTACAGAAA
GGAACTGCCCACGATGTGTTTGAACCGAAACCGGACCGGGAGGTCATGAATGCGCAGCGGCTGTTCAGTA
CGGCACGGGAACTGCGGGACGTGGCGGCAGGCCGTGCCGTTCTCCGTCAGGCGGGGCTGGCCGGGGGAGA
CAGTCCTGCACGGTTTATTGCTCCGGGACGTAAATATCCGCAGCCGTATGTGGCACTGCCGGCGTTTGAC
CGTAACGGCAAGTCCGCCGGTATCTGGCTGAACCCACTGACCACGGATGACGGAAACGGGCTGCGGGGAT
TCAGTGGTGAAGGACGGGTGAAGGGCAGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGCAGCCGTAACGG
AGAAAGCCTGCTGGCTGATAATATGCAGGATGGTGTCCGGATTGCCCGTGATAATCCTGACAGCGGTGTG
GTGGTGAGAATTGCCGGTGAAGGTCGTCCGTGGAATCCCGGTGCCATCACCGGTGGTCGCGTGTGGGGGG
ATATTCCGGATAACAGCGTTCAGCCGGGTGCCGGAAACGGTGAACCGGTCACGGCAGAGGTACTGGCACA
GCGGCAGGCTGAAGAGGCCATCCGCCGTGAAACGGAACGCCGCGCAGATGAAATTGTCCGTAAAATGGCA
GAGAACAAACCTGACCTGCCGGACGGCAGAACAGAGCAGGCTGTCAGGGAGATTGCCGGGCAGGAGCGTG
AACGGGCTGTCACTTCTGAACGGGAAGCCGCGCTGCCGGAGAGTGTACTGCGTGAACCACAACGGGAGCG
GGAAGCGGTCCGTGAGGTTGTCCGGGAAAACCTGCTGCAGGAGCGACTGCAGCAGATGGAGCGGGATATG
GTCCGTGACCTGCAGAAAGAGAAAACCCTGGGCGGAGACTGA
 Primer design