SecReT4
Protein ID: 253801058
T4SS name [ID]Tra_F [109]
Gene symboltraX
Locus tagpVir_84
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]88599..89060 [+]
Productconjugal transfer acetylation protein TraX
Component typeTraX_F
UniProt IDC5ZZM8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2e-25, Aligned region: 1..152
Protein Sequence: 153 a.a.     [Download]
>gi|253801058|ref|YP_003034059.1| conjugal transfer acetylation protein TraX [Escherichia coli Vir68]
MAVIAQFSYYLAGFPWYEGNILFAFAVAAQVLTWCETRSLWRTAAAILLMALWGPLSGTSYGITGLLMLA
VSHRLYRAEDRTERLALVACLLAVIPALNLASSDAAAVAGLVMTVLTVGLVSRAGKSLPRFWPGDFFPTF
YGCHLAVLGILAL
 
Nucleotide Sequence: 462 bp     [Download]
>gi|253800975|ref|NC_012944.1|:88599-89060 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGGCAGTGATTGCCCAGTTCTCGTATTATCTGGCCGGCTTTCCGTGGTATGAGGGGAATATCCTGTTTG
CCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAGACGCGCAGCTTGTGGCGTACTGCTGCGGCCAT
ACTCCTGATGGCACTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTACCGGGCTGCTGATGCTGGCA
GTCAGTCACCGGCTGTACCGGGCGGAAGACAGAACGGAACGTCTGGCGCTGGTTGCATGCCTGCTGGCCG
TGATTCCGGCACTTAACCTTGCCTCCAGTGATGCGGCGGCTGTAGCTGGTCTTGTGATGACGGTGCTGAC
CGTTGGTCTGGTGTCGCGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGAGATTTTTTCCCGACGTTC
TATGGCTGTCATCTGGCTGTGCTGGGCATTCTGGCGTTGTGA
 Primer design