SecReT4
Protein ID: 254003186
T4SS name [ID]Trb [460]
Gene symbol-
Locus tagMsip34_2901
StrainMethylovorus glucosetrophus SIP3-4
Repliconplasmid pMsip01 [GenBank: NC_012970] [Browse all T4SS(s) in this replicon]
Location [Strand]54495..55406 [-]
ProductConjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDC6XER8
KEGG IDmei:Msip34_2901
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.5e-45, Aligned region: 56..273
Protein Sequence: 303 a.a.     [Download]
>gi|254003186|ref|YP_003052652.1| Conjugal transfer protein TrbG/VirB9/CagX [Methylovorus glucosetrophus SIP3-4]
MRRLKWTISILLMVVAGQSAADTTIKKFLSADEAVISAVKRWQQTGRAKPIVSDDGTVYYPFGQYQAKVI
CSPIRVCDIALQAGEKITDAPSTGDDVRWSIFKSVSGSNDLKVNHVVVKPKDLDLETNLIIRTDRRVYHI
DLISRNEGEYINQVAFYYPNDIQDSWRDEELNVAEKKAEVQAQKEVAECTVDIEHLDTAYEIKGGTPGTR
PKFIYNNGTKTCILMPDDAPSWEAAAFVIIGKDDKKQLTNYRVLKQWYVIDKVFDHGALLVGENGSDSRT
DIIWKKSPKQADKPARSTFLGIK
 
Nucleotide Sequence: 912 bp     [Download]
>gi|254003128|ref|NC_012970.1|:c55406-54495 Methylovorus glucosetrophus SIP3-4 plasmid pMsip01, complete sequence
ATGCGTCGTTTAAAATGGACAATTAGTATTTTGTTGATGGTCGTGGCTGGGCAATCAGCGGCTGATACGA
CGATTAAGAAATTCCTAAGCGCTGATGAAGCGGTTATATCAGCCGTGAAGCGCTGGCAACAAACTGGCCG
AGCAAAGCCTATAGTTAGTGATGATGGCACTGTTTATTATCCATTTGGACAGTATCAGGCGAAAGTTATT
TGCTCGCCAATTAGAGTTTGCGATATTGCTTTGCAAGCTGGGGAGAAAATAACTGATGCACCATCCACGG
GTGATGATGTTCGATGGTCAATTTTTAAGTCAGTATCTGGAAGCAATGACTTAAAAGTTAATCATGTTGT
TGTAAAGCCAAAGGATTTGGATCTTGAAACAAATTTGATAATTCGTACTGATCGTCGTGTGTATCACATC
GATCTGATTAGCAGAAATGAAGGCGAGTATATCAATCAGGTCGCATTTTATTATCCAAATGATATACAAG
ATTCGTGGCGCGATGAAGAATTGAACGTGGCCGAAAAGAAAGCCGAAGTGCAAGCTCAGAAAGAAGTTGC
TGAATGCACAGTTGATATTGAACATCTTGATACCGCTTATGAAATCAAAGGCGGTACACCTGGTACCCGT
CCTAAGTTCATTTATAACAATGGTACGAAAACATGCATTCTTATGCCTGATGATGCACCGAGCTGGGAAG
CTGCAGCGTTCGTGATAATTGGGAAAGATGACAAAAAGCAGCTCACTAATTACCGAGTACTTAAGCAATG
GTATGTCATCGATAAAGTTTTTGACCATGGCGCGTTGCTGGTTGGTGAAAATGGTTCGGATAGCCGCACT
GATATCATTTGGAAGAAATCCCCTAAACAAGCCGATAAACCAGCGCGATCGACGTTTCTGGGTATAAAGT
AA
 Primer design