SecReT4
Protein ID: 254003188
T4SS name [ID]Trb [460]
Gene symbol-
Locus tagMsip34_2903
StrainMethylovorus glucosetrophus SIP3-4
Repliconplasmid pMsip01 [GenBank: NC_012970] [Browse all T4SS(s) in this replicon]
Location [Strand]56169..57518 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDC6XES0
KEGG IDmei:Msip34_2903
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.7e-19, Aligned region: 64..289
Protein Sequence: 449 a.a.     [Download]
>gi|254003188|ref|YP_003052654.1| P-type conjugative transfer protein TrbL [Methylovorus glucosetrophus SIP3-4]
MSRITQHLSIKIFIVVLWTMFPTYGFSAGDLGEVLSQYKTSSMTFYGALQGFALSLLLKLWMVEMSWASI
KWVLERKPFEDLLSHFVSASFPPLFFVLVIKMGNTWFPTILESFEFFGTKGSGLSADSASLDPGVILEKG
IILQNQMVQKFNTIAGTGPIEALQNILPSLLLMAVCIIILIAFALMAANVFLVWAEAYLLIGVSPILLAF
AGMRWTRDMAPKTFNSMIAAGIKILVLMLLMSIFTQLVPKWATEAASWTMQDWSPLWRVAFSAAGCAFFA
WKAPQIAANAISGTSSLTAGDALQIAAMAATAAVGGAALAAGAADKVLNGASEALTKGGGAVSNGLMSMG
GPSIEPITSSAVIPDPTGPSPISDGSTATTSNSPQGNASGATISGTDGQNIEKMFDNFASQIKPKPTLSE
KIQGGVRAFQSTVPNDQASVGGDAVKMKE
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|254003128|ref|NC_012970.1|:c57518-56169 Methylovorus glucosetrophus SIP3-4 plasmid pMsip01, complete sequence
ATGAGCCGCATAACTCAACATCTCTCGATTAAGATATTTATTGTTGTATTATGGACAATGTTTCCCACAT
ATGGCTTTTCTGCGGGCGATCTTGGGGAGGTTTTGAGTCAATACAAGACTAGCTCAATGACCTTTTACGG
CGCGTTACAGGGTTTCGCCCTATCCCTGCTTTTAAAGTTATGGATGGTTGAAATGTCTTGGGCGTCCATA
AAATGGGTTCTCGAACGAAAGCCTTTTGAAGATTTGCTTTCGCATTTCGTATCCGCATCTTTTCCGCCTT
TGTTTTTTGTACTTGTCATTAAAATGGGAAATACATGGTTCCCCACTATCCTGGAAAGCTTTGAGTTTTT
TGGTACTAAAGGTAGTGGGTTATCTGCTGATTCTGCCTCTCTTGATCCCGGTGTTATATTAGAAAAGGGG
ATCATTCTTCAAAATCAAATGGTGCAAAAGTTCAACACCATCGCTGGAACAGGACCAATCGAAGCACTCC
AAAATATACTGCCCTCATTGTTACTAATGGCAGTTTGCATCATCATCCTAATTGCATTCGCATTGATGGC
AGCCAATGTATTTCTCGTTTGGGCAGAAGCCTATTTACTTATTGGGGTGTCCCCAATTCTTTTGGCTTTT
GCCGGTATGCGTTGGACTAGGGACATGGCGCCAAAGACGTTTAACAGCATGATTGCGGCGGGTATTAAAA
TACTTGTTCTCATGCTTCTCATGTCTATCTTTACTCAATTGGTGCCTAAGTGGGCAACTGAAGCAGCAAG
TTGGACAATGCAGGATTGGAGTCCTCTGTGGCGTGTAGCATTCTCGGCGGCTGGCTGCGCGTTTTTTGCA
TGGAAAGCACCTCAAATCGCGGCCAACGCCATCTCAGGTACATCAAGTCTTACTGCAGGCGATGCTTTAC
AAATAGCTGCAATGGCGGCAACAGCCGCTGTTGGCGGTGCCGCGCTCGCGGCCGGAGCAGCAGATAAAGT
GCTTAATGGCGCTTCTGAAGCGCTGACGAAAGGTGGAGGTGCTGTCAGCAATGGCCTTATGAGTATGGGG
GGGCCCTCTATTGAGCCCATAACCTCATCTGCAGTTATTCCAGATCCAACTGGGCCATCACCAATTAGTG
ATGGCAGCACTGCTACTACCTCTAACTCGCCACAAGGAAATGCCAGTGGGGCCACTATTAGTGGTACGGA
TGGTCAAAACATTGAAAAAATGTTTGATAATTTCGCTTCGCAAATTAAGCCAAAGCCAACGTTAAGTGAA
AAAATACAAGGCGGGGTCAGGGCTTTCCAATCCACTGTACCAAATGATCAGGCGAGCGTTGGTGGCGATG
CCGTCAAAATGAAGGAATAA
 Primer design