SecReT4
Protein ID: 254003191
T4SS name [ID]Trb [460]
Gene symbol-
Locus tagMsip34_2906
StrainMethylovorus glucosetrophus SIP3-4
Repliconplasmid pMsip01 [GenBank: NC_012970] [Browse all T4SS(s) in this replicon]
Location [Strand]61024..61353 [-]
Productconjugal transfer protein
Component typeTrbD
UniProt IDC6XES3
KEGG IDmei:Msip34_2906
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 6.6e-11, Aligned region: 1..92
Protein Sequence: 109 a.a.     [Download]
>gi|254003191|ref|YP_003052657.1| conjugal transfer protein [Methylovorus glucosetrophus SIP3-4]
MSNQLHTSKIRSSLIRPLGWMGGERLLVLFALLLSIYFAFIYSLTVGLWQAAVVSLSIWGISMAVLTRMG
KHDMQMLKVYWRHRKYKTFYPAKGRLNSPVREMGPFSGK
 
Nucleotide Sequence: 330 bp     [Download]
>gi|254003128|ref|NC_012970.1|:c61353-61024 Methylovorus glucosetrophus SIP3-4 plasmid pMsip01, complete sequence
ATGTCTAACCAATTACATACATCCAAAATTCGTTCTTCCCTCATTCGACCACTTGGTTGGATGGGGGGGG
AGCGACTGCTCGTGCTTTTTGCCCTTTTATTGTCGATCTATTTTGCCTTCATATATTCGCTGACAGTAGG
TCTTTGGCAAGCAGCCGTGGTGTCATTAAGTATCTGGGGTATATCAATGGCCGTTTTAACCCGTATGGGT
AAGCATGATATGCAGATGCTTAAGGTTTACTGGCGACATAGAAAATACAAGACCTTTTATCCGGCGAAGG
GCCGCCTCAATTCCCCTGTCAGGGAGATGGGCCCATTCTCTGGAAAATAA
 Primer design