SecReT4
Protein ID: 254003192
T4SS name [ID]Trb [460]
Gene symbol-
Locus tagMsip34_2907
StrainMethylovorus glucosetrophus SIP3-4
Repliconplasmid pMsip01 [GenBank: NC_012970] [Browse all T4SS(s) in this replicon]
Location [Strand]61346..61777 [-]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDC6XES4
KEGG IDmei:Msip34_2907
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.6e-14, Aligned region: 29..120
Protein Sequence: 143 a.a.     [Download]
>gi|254003192|ref|YP_003052658.1| Conjugal transfer protein TrbC [Methylovorus glucosetrophus SIP3-4]
MTENRIYRFLNKYNNQYFMKGLVMKNMNLRYVKSAMLLIVLLGLPLAAFAAGESAPWDGALCWLVGALKG
KTALAVATIAFVAAAVGFVWGEQLTGIFKTMVNIFVAVCIMLGASSIVNIIASKVDSSYGQQCAQITTIV
TNV
 
Nucleotide Sequence: 432 bp     [Download]
>gi|254003128|ref|NC_012970.1|:c61777-61346 Methylovorus glucosetrophus SIP3-4 plasmid pMsip01, complete sequence
ATGACAGAGAATCGAATCTACCGATTCTTGAACAAGTATAACAATCAATATTTTATGAAAGGTTTAGTTA
TGAAAAATATGAATCTCCGTTACGTCAAATCTGCAATGCTGCTAATCGTCCTGCTGGGGCTTCCTCTTGC
AGCGTTTGCTGCTGGAGAGTCGGCACCATGGGATGGCGCACTTTGCTGGCTTGTAGGTGCTCTTAAGGGT
AAAACCGCTCTTGCAGTAGCGACGATAGCATTTGTAGCGGCTGCAGTAGGTTTTGTTTGGGGTGAGCAGT
TGACAGGCATTTTCAAGACGATGGTCAATATTTTCGTTGCAGTTTGTATCATGCTGGGTGCGTCGAGTAT
TGTGAATATCATTGCAAGTAAAGTGGATAGCAGTTATGGCCAGCAATGCGCTCAAATTACTACCATCGTT
ACTAATGTCTAA
 Primer design