SecReT4
Protein ID: 254293034
T4SS name [ID]Trb [290]
Gene symbol-
Locus tagHbal_0659
StrainHirschia baltica ATCC 49814
Repliconchromosome [GenBank: NC_012982] [Browse all T4SS(s) in this replicon]
Location [Strand]704251..705246 [-]
ProductATPase P
Component typeTrbG
UniProt IDC6XNV7
KEGG IDhba:Hbal_0659
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-69, Aligned region: 97..318
Protein Sequence: 331 a.a.     [Download]
>gi|254293034|ref|YP_003059057.1| ATPase P [Hirschia baltica ATCC 49814]
MIRKSLLASVSLLLVTACTTTEVTPITPKDFIAARPLEDLSEHPVQIVETTVPLPLPGQMKKIGPQAPSK
KKITPEQAIKEGRQHALIEPSVDGYVNAIQIYPYTEGALYRLYASPGQISDIALQVGEELVSVSAGDTVR
WVVGDTLSGSGSTSRAHVLVKPISADIRTNLMIATNKRTYHLELESVSSGYMAALSWRYPKDAFAELTTK
NDRAHARAANSIESGLTLEDLNFDYKLTGQSPPWKPVRVFDDGAQVFIQMPENIKTSDMPPLFVVGQSGD
AELVNYRIKNNYYIVDRLFRAAELRLGTKRQTIVRIERVKARTGLAALFGS
 
Nucleotide Sequence: 996 bp     [Download]
>gi|254292376|ref|NC_012982.1|:c705246-704251 Hirschia baltica ATCC 49814 chromosome, complete genome
ATGATCCGTAAATCCCTCTTAGCATCTGTCTCTCTTTTACTTGTGACAGCTTGCACCACAACTGAGGTTA
CCCCCATTACACCTAAAGATTTTATAGCTGCTAGACCTCTGGAAGACTTAAGTGAACATCCCGTCCAAAT
TGTTGAAACAACTGTACCGCTCCCCTTGCCCGGACAAATGAAAAAGATAGGTCCCCAAGCGCCATCTAAA
AAGAAGATTACACCTGAACAAGCGATCAAAGAAGGACGCCAACACGCGCTGATCGAGCCTTCAGTGGATG
GGTATGTCAACGCGATACAAATCTATCCTTATACCGAAGGCGCGCTCTATCGTCTCTATGCCAGCCCAGG
ACAAATCAGTGATATTGCCTTGCAGGTCGGCGAAGAGCTGGTATCGGTCTCCGCAGGTGACACCGTGAGA
TGGGTTGTGGGTGATACGCTCTCAGGGTCGGGTTCAACATCGCGTGCGCATGTCTTAGTAAAACCTATAA
GTGCAGATATCCGCACGAATTTGATGATTGCTACCAATAAACGCACTTACCATCTTGAATTAGAATCTGT
GTCATCTGGCTATATGGCAGCTTTATCCTGGCGCTATCCAAAAGATGCTTTTGCTGAACTGACAACTAAG
AACGATCGCGCGCATGCAAGAGCAGCCAATTCCATTGAAAGTGGTCTTACACTCGAAGACTTAAACTTTG
ATTATAAGCTGACAGGACAATCCCCGCCCTGGAAGCCGGTACGTGTCTTTGATGATGGCGCACAAGTCTT
CATCCAAATGCCTGAAAATATCAAAACATCGGATATGCCACCTCTTTTTGTTGTTGGACAATCAGGGGAT
GCAGAATTGGTCAATTACCGCATCAAGAATAATTATTATATTGTCGACCGTCTATTTCGTGCAGCTGAAT
TACGCCTTGGCACCAAACGCCAAACAATCGTGCGCATAGAGCGGGTAAAAGCTCGCACCGGCCTTGCTGC
CCTATTTGGAAGCTAG
 Primer design