SecReT4
Protein ID: 254293037
T4SS name [ID]Trb [290]
Gene symbol-
Locus tagHbal_0662
StrainHirschia baltica ATCC 49814
Repliconchromosome [GenBank: NC_012982] [Browse all T4SS(s) in this replicon]
Location [Strand]706143..707447 [-]
ProductATPase P
Component typeTrbL
UniProt IDC6XNW0
KEGG IDhba:Hbal_0662
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.2e-50, Aligned region: 34..260
Protein Sequence: 434 a.a.     [Download]
>gi|254293037|ref|YP_003059060.1| ATPase P [Hirschia baltica ATCC 49814]
MDIIDTFLATFITYIDSGFGLLAGDVAYLSSTLIVIDITLAGLFWALSSNHDVIGSLIKKILYVGFFAFI
IGNFTFLATIIFDSFAGLGLRAGGGTMTASDLLRPGHIAGVGFEAAAPLLEEISELLGPVSFFHNFVLIA
VMFIAWAVIILAFFILAVQLFITILEFKLTTLTGFILVPFALWNKTSFLAERVLGNVMSSGIKLMVLAVI
IGIGSNLFVSVTDAFTNDVDITLSQVMGTVLASIVFFWMGIFSPSIAAGLITGAPQLGAGSAAGAAAGLA
ASGYVAGMGSRAAVSAAASGGGNAIKAGTSMAGAARTAYSMGSVASGKTGTSAIASGMGGIARAGGDALK
AQTAKPLNSVKQAYTRGSQSVWSATGGLPSSEPSASSNTQPDNWAKRFQTQQRIGQASSAALHSVRDGDR
GASGASPSLQNKDE
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|254292376|ref|NC_012982.1|:c707447-706143 Hirschia baltica ATCC 49814 chromosome, complete genome
ATGGATATCATTGATACCTTCTTAGCCACTTTCATTACCTATATTGATTCAGGCTTTGGATTACTTGCTG
GTGATGTTGCTTATCTATCCAGCACTCTCATCGTAATTGATATTACATTAGCTGGCTTATTTTGGGCACT
CTCTTCTAATCACGACGTGATTGGCAGCCTTATCAAGAAGATACTCTATGTTGGCTTTTTTGCCTTCATC
ATTGGTAATTTCACGTTTTTAGCGACGATCATTTTTGATAGTTTTGCAGGTCTTGGCCTTCGCGCTGGTG
GTGGCACCATGACAGCGAGCGACCTCTTACGCCCTGGCCATATTGCTGGTGTTGGATTTGAAGCAGCCGC
CCCACTATTAGAGGAAATTTCTGAACTTTTAGGGCCGGTAAGCTTTTTTCATAATTTTGTTTTGATAGCT
GTCATGTTCATTGCCTGGGCTGTCATCATATTGGCCTTTTTTATCTTAGCCGTGCAGCTTTTTATCACCA
TTTTAGAGTTTAAGCTCACCACGCTGACAGGCTTTATACTCGTGCCTTTTGCACTTTGGAATAAGACAAG
TTTCTTAGCCGAACGCGTTTTGGGTAATGTCATGAGTTCGGGCATTAAACTCATGGTGCTCGCTGTCATA
ATAGGTATTGGGTCTAACCTTTTTGTCAGCGTCACGGATGCTTTTACCAATGATGTCGATATCACCTTAT
CACAGGTTATGGGCACAGTGCTCGCGTCTATTGTTTTCTTCTGGATGGGAATATTTTCACCCAGTATTGC
TGCAGGTTTAATAACGGGGGCACCGCAATTGGGCGCTGGTTCTGCAGCAGGCGCTGCGGCTGGTCTTGCA
GCATCGGGCTATGTCGCTGGAATGGGTAGCCGTGCAGCAGTTAGCGCAGCAGCATCTGGAGGTGGCAACG
CGATTAAAGCAGGCACCTCAATGGCCGGTGCTGCACGCACGGCATATTCAATGGGCTCTGTTGCTTCGGG
TAAAACCGGTACAAGTGCCATTGCTAGCGGCATGGGCGGTATCGCACGCGCAGGTGGCGATGCATTAAAG
GCGCAAACTGCAAAGCCTCTCAATAGTGTTAAACAAGCCTACACCAGGGGCAGCCAATCAGTTTGGTCCG
CGACGGGTGGCTTACCCTCTTCTGAGCCATCAGCCTCTTCAAATACTCAGCCAGATAATTGGGCAAAGCG
TTTTCAAACCCAGCAACGTATTGGTCAGGCCAGCAGCGCCGCTCTGCATAGCGTACGTGATGGAGATCGC
GGCGCATCTGGCGCAAGCCCCAGTTTACAAAACAAGGACGAATAA
 Primer design