SecReT4
Protein ID: 254293041
T4SS name [ID]Trb [290]
Gene symbol-
Locus tagHbal_0666
StrainHirschia baltica ATCC 49814
Repliconchromosome [GenBank: NC_012982] [Browse all T4SS(s) in this replicon]
Location [Strand]710829..711140 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDC6XNW4
KEGG IDhba:Hbal_0666
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-22, Aligned region: 10..94
Protein Sequence: 103 a.a.     [Download]
>gi|254293041|ref|YP_003059064.1| conjugal transfer protein Trbc [Hirschia baltica ATCC 49814]
MRKPALKYLTLLSASIAFSVSAHAAGTGMPWEEPLDQVLQSIEGPVARIVAVLIITVTGLTLAFGETSGG
MRKLVQIVFGLSIAFAATSFFLTFFSFGGGALI
 
Nucleotide Sequence: 312 bp     [Download]
>gi|254292376|ref|NC_012982.1|:c711140-710829 Hirschia baltica ATCC 49814 chromosome, complete genome
ATGCGCAAACCCGCACTAAAATATTTAACGCTCCTGTCTGCTTCAATCGCTTTTTCTGTCTCAGCCCATG
CCGCTGGAACGGGCATGCCGTGGGAAGAGCCCCTGGATCAGGTCTTACAATCCATTGAGGGACCTGTTGC
CCGTATTGTGGCTGTTCTCATCATTACAGTGACAGGCCTCACCCTTGCCTTTGGTGAAACTTCAGGCGGC
ATGCGCAAACTTGTCCAAATTGTTTTTGGCCTGTCTATCGCCTTTGCAGCCACAAGCTTCTTTTTGACCT
TCTTCTCCTTTGGTGGAGGCGCGCTCATCTAA
 Primer design