SecReT4
Protein ID: 254796597
T4SS name [ID]VirB [477]
Gene symbol-
Locus tagNRI_0203
StrainNeorickettsia risticii str. Illinois
Repliconchromosome [GenBank: NC_013009] [Browse all T4SS(s) in this replicon]
Location [Strand]190345..190992 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDC6V479
KEGG IDnri:NRI_0203
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.6e-07, Aligned region: 34..204
Protein Sequence: 215 a.a.     [Download]
>gi|254796597|ref|YP_003081433.1| type IV secretion system protein VirB8 [Neorickettsia risticii str. Illinois]
MHERDLKEALVEGGKYYKEGLSWHCTKNYYVFVERVWLLMFLALLFSTLCVMGLNIYSILPLKTTTNFLR
YTDSIDTDNIKTTRLYDVYKKNNDLQTVIDRYLLSEYIEVWEEGTGQEDKFIQLNSSHMVYEKFLKSRSG
ITNTMNKRTEIADVQIHKDTKTSGKVAVAKVRSYEDGSKNQEKTVKVAFRTTDVILAHRNIAPLELIVSG
YEEIQ
 
Nucleotide Sequence: 648 bp     [Download]
>gi|254796400|ref|NC_013009.1|:c190992-190345 Neorickettsia risticii str. Illinois, complete genome
ATGCACGAACGAGATCTAAAAGAAGCTCTTGTTGAAGGAGGTAAGTATTACAAAGAGGGCCTCTCATGGC
ACTGTACAAAGAACTATTATGTCTTCGTGGAACGCGTCTGGTTGCTTATGTTTCTCGCGCTCCTTTTTTC
CACACTCTGTGTGATGGGACTGAACATATATTCTATCCTACCACTTAAAACAACTACTAACTTTCTTCGT
TACACGGACAGCATAGACACAGACAATATAAAAACCACCAGGTTGTACGACGTGTACAAAAAAAATAATG
ACTTGCAGACGGTCATAGACAGATATTTACTCTCGGAGTACATAGAAGTATGGGAAGAAGGGACAGGACA
AGAAGACAAATTTATACAACTAAACTCTTCTCATATGGTTTATGAGAAATTCCTTAAATCCAGATCTGGG
ATTACCAATACAATGAACAAACGCACCGAAATAGCTGACGTGCAAATTCATAAAGATACCAAGACTAGTG
GAAAAGTAGCTGTAGCAAAGGTAAGATCCTATGAAGATGGTAGTAAGAACCAAGAAAAAACGGTAAAGGT
TGCTTTCAGGACGACAGATGTTATTTTGGCGCATAGAAACATCGCACCATTAGAATTAATAGTAAGCGGT
TATGAAGAGATCCAATAG
 Primer design