SecReT4
Protein ID: 254797086
T4SS name [ID]VirB [477]
Gene symbol-
Locus tagNRI_0713
StrainNeorickettsia risticii str. Illinois
Repliconchromosome [GenBank: NC_013009] [Browse all T4SS(s) in this replicon]
Location [Strand]676486..678411 [-]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDC6V5M0
KEGG IDnri:NRI_0713
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.2e-143, Aligned region: 120..559
TraG-D_C [PF12696], Evalue: 2.3e-26, Aligned region: 403..525
TrwB_AAD_bind [PF10412], Evalue: 1.1e-23, Aligned region: 235..539
AAA_10 [PF12846], Evalue: 4.2e-05, Aligned region: 366..480
Protein Sequence: 641 a.a.     [Download]
>gi|254797086|ref|YP_003081924.1| type IV secretion system component VirD4 [Neorickettsia risticii str. Illinois]
MRQLRNIVTIFFLLAFIFALALYMSAAIFVVAVWGIEHLNFRDLQPSLDRFPTRLWPTIFVYISDLFKNW
DAWAPAVKIKLAVSLGIPFGILGVVFYMLRAPIIEWRPFKKKESVHGDARWATEREIRKIGLRSRKGILL
GKDKKGFLIAGGFQHALLFAPTGSGKGVGFVIPNLLFWEDSVVVHDIKLENFSLTSGYRKKMGQKVYCWS
PADPDGKSHCYNPLDWVSSKPGQMVDDVQKIANLLMPEQDFWVNEARSLFLGVVLYILAVPEKVKSFGEV
VRVMRSDDVTYSLAVALDTMGKKIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDTTTATSD
FNFMKFKKELTTVYVGLTPDNLTRLQPLMQVFYQQATEFLCRHLPQKDEPYGVLFMMDEFPTLGEMEQFK
TGIAYFRGYNVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLVGNKTVAQESL
NKPKFLDLNPASRSLHISETQRALLLPQEVIMLPRDQQILLIESTYPIKSKKIRYYEDTFFTKKILDPIS
IPTQEPFDPKKFEEKMRKEREAKELEENAPLAIDEDQALLEDESLLDDSDYEDGDFEDLDEEEDLSDFLD
DTDEENEENMA
 
Nucleotide Sequence: 1926 bp     [Download]
>gi|254796400|ref|NC_013009.1|:c678411-676486 Neorickettsia risticii str. Illinois, complete genome
ATGAGACAACTTAGGAATATTGTAACGATATTTTTTCTGCTGGCGTTCATTTTCGCCCTGGCCCTTTACA
TGTCAGCGGCTATTTTTGTGGTTGCAGTTTGGGGAATAGAACACCTCAACTTTCGTGATTTGCAGCCATC
TTTGGACAGGTTTCCTACACGTCTTTGGCCGACAATTTTTGTCTATATAAGTGATCTTTTCAAGAATTGG
GACGCTTGGGCCCCAGCTGTAAAGATAAAACTTGCTGTCTCGTTAGGCATTCCATTTGGAATACTTGGAG
TCGTCTTTTATATGCTTCGTGCACCGATTATTGAGTGGCGTCCATTCAAAAAGAAAGAATCTGTGCATGG
TGATGCAAGGTGGGCAACAGAAAGGGAAATAAGAAAAATCGGACTTAGAAGCCGTAAAGGGATACTGCTT
GGTAAAGATAAGAAAGGTTTCCTCATTGCAGGGGGGTTTCAGCATGCTTTACTATTTGCTCCAACTGGTT
CTGGGAAGGGTGTTGGTTTTGTTATCCCAAATCTTCTCTTCTGGGAAGATTCTGTTGTTGTTCACGATAT
CAAACTTGAGAACTTCAGCTTAACTAGCGGTTATAGGAAAAAGATGGGGCAGAAGGTCTACTGTTGGAGT
CCAGCTGACCCAGATGGTAAAAGTCACTGCTATAATCCGTTGGATTGGGTTAGTTCGAAACCTGGGCAGA
TGGTGGATGATGTTCAAAAAATCGCTAACCTCCTAATGCCCGAACAGGATTTCTGGGTGAATGAAGCCCG
AAGTCTTTTTCTGGGAGTAGTGCTGTACATCCTTGCGGTACCGGAAAAGGTAAAGTCCTTTGGAGAGGTA
GTAAGAGTGATGAGAAGCGATGATGTTACATATAGTCTCGCTGTTGCATTAGACACAATGGGTAAAAAGA
TTCACCCAGTTGCCTATATGAACATTGCTGCTTTTCTTCAAAAGGCGGATAAGGAAAGATCTGGTGTGAT
ATCGACAATGAACTCCTCGCTTGAATTGTGGGCAAACCCGCTTATTGATACCACGACAGCTACTAGTGAC
TTTAATTTTATGAAGTTCAAAAAAGAGCTTACCACCGTATACGTCGGTCTTACGCCGGATAACTTGACGA
GGTTACAGCCGCTCATGCAGGTTTTTTATCAACAAGCAACTGAGTTTTTGTGTAGGCATCTTCCACAGAA
AGATGAACCGTATGGTGTTCTATTTATGATGGATGAGTTCCCTACTCTTGGTGAGATGGAACAGTTTAAA
ACTGGTATCGCATATTTTCGTGGGTACAACGTCCGTCTGTTTCTTATCATTCAAGATACGGAGCAGTTAA
AAGGTATCTACGAAGAAGCAGGAATGAACTCTTTTCTCTCGAACTCTACCTACAGAATTACTTTTGCTGC
AAACAACATAGAAACGGCAAATTTAATTTCCCAGTTGGTTGGGAATAAGACAGTTGCACAGGAATCGCTT
AACAAACCGAAGTTTCTTGACTTGAATCCTGCATCGAGGTCGCTGCATATTTCTGAGACTCAGCGTGCGC
TTCTGTTGCCTCAGGAGGTGATAATGTTGCCGCGTGATCAGCAGATTCTATTAATTGAATCTACCTACCC
TATCAAATCAAAAAAGATACGGTACTACGAAGATACTTTTTTCACGAAAAAAATTCTCGATCCTATTTCT
ATCCCGACCCAAGAACCATTTGATCCAAAAAAATTTGAAGAAAAGATGCGTAAGGAAAGGGAGGCTAAGG
AATTAGAGGAGAATGCTCCATTGGCTATAGATGAAGATCAAGCGCTTCTCGAGGACGAGTCTCTTTTAGA
TGATTCTGATTACGAAGATGGAGACTTTGAGGATCTAGATGAAGAAGAGGATTTGTCCGATTTTTTAGAT
GACACGGACGAAGAGAACGAAGAAAACATGGCATGA
 Primer design