SecReT4
Protein ID: 254797087
T4SS name [ID]VirB [477]
Gene symbolvirB
Locus tagNRI_0714
StrainNeorickettsia risticii str. Illinois
Repliconchromosome [GenBank: NC_013009] [Browse all T4SS(s) in this replicon]
Location [Strand]678443..679438 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDC6V5M1
KEGG IDnri:NRI_0714
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-88, Aligned region: 10..310
Protein Sequence: 331 a.a.     [Download]
>gi|254797087|ref|YP_003081925.1| type IV secretion system ATPase VirB11 [Neorickettsia risticii str. Illinois]
MQYTALNKYLEPLDALFQDSDVNEISINKPGEVWIEKKGEIMRSELPELDFQHLKGLAKLVAQATEQNVS
GEFPLLSAALPNECRVQLVLPPVAEAGTVVISIRKPSSIQLSLADYEAMGAFEKLKCRDVPLDIDNRLRE
LLKGGDVKSFLELAIKEKKNIIISGGTSTGKTTFTNSLLHEIPTYERIITVEDAREVVLSKHPNRVHLVA
SKGGQGRANVTAQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADAPKMAIEQLKLM
VMQAGLGIPPEQIKEYIMNVVDVIVQLKRAGHGKRFVSEILLTKDLLEVGN
 
Nucleotide Sequence: 996 bp     [Download]
>gi|254796400|ref|NC_013009.1|:c679438-678443 Neorickettsia risticii str. Illinois, complete genome
ATGCAATACACAGCTCTGAATAAATATCTGGAGCCCTTGGATGCGCTATTTCAGGATAGCGATGTCAATG
AGATCTCGATCAATAAACCTGGGGAGGTGTGGATCGAAAAGAAGGGTGAGATTATGAGATCTGAACTTCC
TGAGCTTGACTTTCAACATCTTAAAGGACTTGCGAAATTGGTTGCTCAGGCCACCGAGCAAAATGTCAGT
GGAGAGTTTCCACTTCTCTCTGCTGCTTTGCCGAATGAGTGCCGGGTTCAGTTGGTTTTGCCACCTGTTG
CAGAAGCTGGGACGGTTGTAATTTCAATAAGGAAGCCTAGCAGCATACAACTGTCTCTTGCTGATTATGA
AGCAATGGGCGCATTTGAGAAACTTAAGTGTCGTGATGTTCCACTTGATATAGATAATCGTCTCCGCGAG
CTTCTGAAGGGTGGTGATGTAAAAAGTTTCCTCGAACTTGCAATAAAAGAAAAAAAGAACATCATCATCA
GTGGTGGTACATCGACCGGTAAGACGACTTTTACCAATAGCCTGCTTCACGAAATACCGACTTATGAGAG
GATTATTACGGTCGAAGATGCGCGAGAGGTAGTGTTGTCTAAGCATCCGAATAGGGTGCATTTAGTTGCT
TCAAAGGGTGGACAAGGTCGTGCTAATGTTACAGCTCAAGATCTGATAGAAGCATGTTTGCGCCTTCGTC
CTGACAGAATTATAGTTGGTGAATTAAGGGGTGCAGAGGCTTTTAGTTTTCTTAGGGCTATTAATACAGG
GCATCCAGGCTCGATTTCCACTTTACATGCGGACGCTCCGAAGATGGCTATAGAACAACTGAAACTTATG
GTAATGCAGGCCGGTTTAGGAATTCCTCCTGAGCAAATTAAGGAATATATAATGAATGTGGTAGATGTTA
TTGTTCAGCTCAAAAGAGCGGGCCATGGGAAGAGATTTGTTTCCGAGATCTTGCTTACCAAGGACCTGCT
TGAGGTTGGTAATTGA
 Primer design