SecReT4
Protein ID: 254797091
T4SS name [ID]VirB [477]
Gene symbol-
Locus tagNRI_0718
StrainNeorickettsia risticii str. Illinois
Repliconchromosome [GenBank: NC_013009] [Browse all T4SS(s) in this replicon]
Location [Strand]681538..682248 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDC6V5M5
KEGG IDnri:NRI_0718
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.2e-51, Aligned region: 26..234
Protein Sequence: 236 a.a.     [Download]
>gi|254797091|ref|YP_003081929.1| type IV secretion system protein VirB8 [Neorickettsia risticii str. Illinois]
MWFAFCISDGCMVRFFKSKSEAKQKVAHWYEEHIGRVTLQRNFLVVMNLGVIVALMLVVFALFAVSSSRT
IEPFVIEVSKKTGTIARVNPATVKEYSANRAITNYFVTQYVKAREVFHPATYRYDYYTTVRVFSDPRLYT
MFKGSLSLSNPTSPLNLYANVADSKYEVRSIRHLDSDTVQMRITIRFVSSDGGVSVTNKIVSVRYSYMDL
DLSEEDRRLNPLGFVVVSYQVDDDHS
 
Nucleotide Sequence: 711 bp     [Download]
>gi|254796400|ref|NC_013009.1|:c682248-681538 Neorickettsia risticii str. Illinois, complete genome
GTGTGGTTTGCGTTCTGTATTTCTGATGGGTGTATGGTGAGGTTTTTCAAAAGCAAAAGCGAAGCGAAAC
AAAAGGTGGCCCACTGGTACGAGGAGCACATAGGGCGGGTTACTCTGCAAAGGAACTTTCTTGTGGTGAT
GAACTTGGGGGTCATAGTGGCCCTCATGTTAGTTGTTTTTGCTTTATTCGCGGTTAGTAGTTCAAGAACG
ATAGAGCCTTTCGTGATCGAGGTTTCCAAGAAAACCGGAACCATAGCACGCGTCAATCCTGCTACGGTAA
AGGAATATTCTGCAAACAGGGCAATAACGAATTATTTTGTTACGCAGTACGTAAAGGCAAGGGAGGTTTT
TCATCCTGCAACGTATCGTTACGATTACTACACTACAGTGAGGGTATTTTCAGATCCTCGCCTTTATACG
ATGTTTAAGGGATCTCTCTCCTTGAGTAATCCTACAAGTCCACTCAACTTATATGCTAATGTAGCGGATT
CTAAATACGAAGTTCGCTCCATAAGACATCTAGACAGTGATACGGTTCAGATGAGAATTACTATAAGATT
CGTAAGTAGTGATGGCGGGGTGAGTGTCACAAATAAGATTGTGTCTGTCAGATACAGTTATATGGACCTT
GATCTTTCAGAAGAGGATAGGCGCCTCAATCCTCTTGGTTTTGTTGTTGTTTCTTATCAGGTAGATGATG
ATCATTCGTGA
 Primer design