SecReT4
Protein ID: 256014855
T4SS name [ID]VirB [367]
Gene symbolvirB11
Locus tagBMI_II61
StrainBrucella microti CCM 4915
Repliconchromosome 2 [GenBank: NC_013118] [Browse all T4SS(s) in this replicon]
Location [Strand]56837..57931 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDC7LGR4
KEGG IDbmr:BMI_II61
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.5e-66, Aligned region: 28..330
Protein Sequence: 364 a.a.     [Download]
>gi|256014855|ref|YP_003104864.1| type IV secretion system protein VirB11 [Brucella microti CCM 4915]
MCMMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYE
HLISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFF
KHVRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITI
EDVPELFLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASGHG
GSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPN
TKRALSLQHSEKTQ
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|256014795|ref|NC_013118.1|:c57931-56837 Brucella microti CCM 4915 chromosome 2, complete sequence
GTGTGTATGATGTCAAACCGAAGTGACTTTATTGTGCCTGACGAGGCGGCCGTCAAACGGGCGGCCTCGG
TCAATTTCCATCTGGAACCGCTGCGCCCTTGGTTGGACGATCCGCAGATCACCGAAGTTTGCGTGAACCG
GCCGGGCGAAGTGTTCTGCGAGCGAGCAAGCGCGTGGGAATACTATGCGGTGCCAAACCTCGACTATGAA
CACCTGATTTCGCTGGGAACCGCCACCGCGCGGTTTGTGGATCAGGATATTTCGGACAGCCGACCGGTGC
TGTCTGCGATCCTGCCGATGGGTGAGCGCATTCAGATTGTGCGCCCGCCCGCATGTGAGCACGGCACCAT
CTCGGTGACGATCCGCAAGCCGTCTTTCACCCGGCGCACACTGGAAGACTATGCGCAGCAGGGCTTTTTC
AAACACGTCAGACCCATGAGTAAGAGCCTGACGCCGTTTGAACAGGAACTGCTCGCATTGAAGGAAGCTG
GTGATTACATGAGCTTCCTGCGGCGGGCGGTACAGCTTGAAAGGGTGATCGTCGTCGCCGGCGAGACGGG
ATCAGGCAAGACCACACTGATGAAAGCGCTGATGCAGGAAATTCCGTTCGATCAGCGCCTGATCACCATC
GAGGACGTACCGGAGTTGTTCTTGCCGGACCATCCGAACCACGTCCACCTGTTTTATCCGAGCGAAGCGA
AGGAAGAAGAAAACGCACCAGTGACGGCCGCCACGCTACTGCGGAGCTGCCTGCGCATGAAACCGACGCG
CATCCTGCTTGCCGAGCTGCGCGGCGGCGAGACTTACGATTTCATCAACGTGGCCGCGTCCGGCCATGGC
GGCAGCATCACCAGTTGCCATGCCGGTTCGTGCGAACTGACTTTCGAGCGGCTGGCATTGATGGTGTTGC
AGAACCGCCAGGGCCGCCAGTTGCCATACGAGATCATCCGCCGGCTGCTCTATCTGGTGGTGGATGTCGT
CGTGCACGTCCACAATGGCGTGCACGACGGCACTGGCCGCCATATATCTGAAGTTTGGTACGACCCGAAT
ACAAAACGGGCACTGTCACTGCAACACAGTGAGAAGACGCAATGA
 Primer design