SecReT4
Protein ID: 256014859
T4SS name [ID]VirB [367]
Gene symbolvirB7
Locus tagBMI_II65
StrainBrucella microti CCM 4915
Repliconchromosome 2 [GenBank: NC_013118] [Browse all T4SS(s) in this replicon]
Location [Strand]60666..60839 [-]
Producttype IV secretion system protein VirB7
Component typeVirB7
UniProt IDC7LGR8
KEGG IDbmr:BMI_II65
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|256014859|ref|YP_003104868.1| type IV secretion system protein VirB7 [Brucella microti CCM 4915]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|256014795|ref|NC_013118.1|:c60839-60666 Brucella microti CCM 4915 chromosome 2, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCAGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design