SecReT4
Protein ID: 256367588
T4SS name [ID]Tra_I [166]
Gene symboltraU
Locus tagpEK204_p56
StrainEscherichia coli plasmid pEK204 (NC_013120)
Repliconplasmid pEK204 [GenBank: NC_013120] [Browse all T4SS(s) in this replicon]
Location [Strand]53287..56331 [-]
ProductTraU protein
Component typeTraU_I
UniProt IDC7SA48
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.7e-46, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|256367588|ref|YP_003108147.1| TraU protein [Escherichia coli]
MNINRFIFTIEDCLNTLSRFSVASSFVEYCDLRTVIGLDRQDRERRPWLNSPYIAATKRGEYLSVFEVSG
AFREMDEASDQTGPGSLESLITSMSDSLNTAYKNSGHKISCVFERDPEMGKEEIEDMVAPQKRSLANTGI
QLQDVVDEKVTTLSPWLVRERCWLAIWSGPDLISNSDRTAHDELVRRLAERVPKARFAQSPWQWTLSALK
IRHEAFLDNVEQALRHSSDGLILRLLDIHEVGREIRRQTERHSTPRNWQPHLPEDAQPAGYRWTDDESVL
HAPSLHLQLFNTQVTTQGNLVQAGGLWHGMVSITLPPQNLQTFNELVRAVPRAVPWRIRMDLMPGGMKAL
NLKKTLLTYSSFISAVRPMYESVMTLAATDEKEPVCIMTIMASTWGKTREICTRNQAILKSAIEGWGVCG
TTTTFGDPRRAWVNTILAASGGSGPVPLYPPLSHAISLFPLNRAGSVWRGKGNLMLHTEDGSAFEVGLAS
SQQNKHTELAPGDPGLGKSVLINTLSEIQISSAQKNLPFIAYIDKGYSAQGLVQLIRDSLPPERKDEAVG
IILSNDPEYTRNLFDVMYGAKKPITPEKNFMSSVLCALCVDTGTGQPCNPGDTRQIINQLIELAFKEYGE
NNPRLYRASTEDLVDSALQDSGLYEKHDAAWWARSTWFEVRDMLHNAGYIMAAQRAHYQAMPQLPEVSSM
LGHTSLRDVFGTVQRDGSNELLLDYIRRALEQGHNDYPMISGYTRFMINPETRVIAVDLNNVAGDKTPAG
RLKTGIMYLLAGQIAGGDFTLPQYRDEVLKQLPREYHEIALKRINQLDQEVKTKVYDELHNARGIDFIWE
NLDTQEREQRKFAIRTVLSTQYLRDYPESVLKSANTLWLLRYKPEDIPVLRDNFNVPEFMLKRFLKMPEG
PAPDGSGVPVLGVFRVKSGTLARILKFTVGPLELWALNSSPKDSALRKTLTNKLGSVRARKILAENFPRG
SATSLIEHRAGQHNSDNVIEDLASELIRKQGYNL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|256367532|ref|NC_013120.1|:c56331-53287 Escherichia coli plasmid pEK204, complete sequence
ATGAACATAAACCGTTTCATCTTCACTATCGAAGACTGTCTGAACACGCTATCCCGTTTCTCTGTCGCAA
GCAGTTTTGTTGAGTATTGCGATTTACGTACTGTAATTGGTCTGGACAGACAGGATCGTGAACGTCGCCC
ATGGCTTAATTCGCCCTATATTGCAGCCACAAAGCGTGGAGAATATCTCTCTGTCTTTGAAGTCAGCGGT
GCTTTCAGGGAAATGGATGAAGCATCCGACCAGACTGGCCCTGGTTCACTGGAATCGCTGATCACCAGCA
TGAGTGACAGCCTGAATACGGCATATAAAAACAGCGGTCATAAAATCAGCTGCGTTTTCGAGCGTGACCC
TGAAATGGGGAAAGAAGAAATCGAAGACATGGTCGCCCCACAAAAACGCTCACTGGCTAATACAGGTATC
CAGTTACAGGATGTGGTCGATGAGAAAGTCACAACACTGTCCCCATGGCTGGTCCGGGAGCGTTGCTGGC
TGGCGATCTGGAGTGGACCCGACCTTATCAGCAACAGCGATCGCACCGCCCATGATGAGCTTGTCAGAAG
ACTGGCTGAACGGGTACCGAAAGCACGCTTTGCCCAGTCCCCCTGGCAGTGGACCTTATCTGCACTGAAA
ATCCGCCACGAAGCTTTTCTTGATAATGTGGAACAGGCACTGAGACATTCATCTGATGGCCTGATTCTCC
GGCTACTGGATATACACGAGGTCGGACGTGAAATACGTCGTCAGACAGAACGGCACAGCACACCGCGTAA
CTGGCAACCCCACCTGCCTGAAGATGCCCAGCCAGCGGGATATCGCTGGACTGACGATGAATCCGTACTA
CATGCTCCTTCATTGCATTTGCAGTTATTCAACACGCAGGTGACCACACAGGGCAACCTGGTTCAGGCGG
GCGGACTCTGGCACGGAATGGTATCGATTACTTTACCTCCGCAAAATCTGCAGACGTTTAACGAACTGGT
CCGTGCTGTCCCCCGCGCAGTCCCCTGGCGCATCAGAATGGATCTGATGCCCGGCGGGATGAAAGCTCTT
AATCTGAAGAAAACGCTTCTGACTTACAGCAGCTTCATTTCTGCCGTTCGTCCAATGTATGAATCCGTTA
TGACCCTGGCGGCAACGGATGAAAAAGAACCTGTCTGCATAATGACCATCATGGCCTCCACGTGGGGAAA
AACACGTGAAATATGCACACGAAACCAGGCCATTCTGAAATCGGCCATTGAAGGCTGGGGCGTATGTGGC
ACCACGACAACATTTGGTGATCCCCGACGCGCCTGGGTGAATACCATTCTCGCGGCATCCGGAGGCTCCG
GCCCGGTTCCCCTGTATCCCCCGTTGTCACATGCCATCTCGCTTTTCCCACTTAACAGGGCAGGCTCTGT
CTGGCGAGGCAAAGGGAATCTGATGTTACATACAGAAGACGGTTCCGCATTTGAGGTTGGTCTGGCGTCA
TCCCAACAAAATAAACATACAGAACTGGCACCAGGCGATCCGGGACTGGGTAAATCAGTTCTGATTAATA
CGTTGTCGGAAATACAGATATCATCTGCTCAGAAAAACCTGCCCTTCATTGCCTATATCGATAAAGGATA
CAGTGCTCAGGGACTGGTTCAGCTTATTCGCGACAGTCTTCCTCCGGAAAGAAAAGACGAAGCTGTCGGT
ATTATTCTGAGCAATGATCCGGAATACACCCGTAACCTTTTTGACGTGATGTACGGCGCTAAAAAGCCTA
TTACGCCGGAAAAGAATTTCATGTCATCGGTGCTGTGTGCTCTCTGTGTCGATACCGGTACCGGTCAACC
CTGTAACCCCGGAGACACCCGACAAATTATCAACCAGCTTATCGAGCTGGCTTTTAAAGAGTACGGTGAA
AATAATCCGCGACTTTATCGCGCCTCAACGGAAGACCTGGTGGATTCAGCACTGCAGGACTCGGGACTGT
ATGAAAAACATGATGCAGCCTGGTGGGCCAGATCAACCTGGTTCGAAGTCCGGGATATGCTCCACAATGC
CGGGTATATCATGGCGGCTCAGCGGGCACATTATCAGGCAATGCCCCAGCTTCCCGAAGTATCCTCTATG
CTGGGCCATACCAGTCTCAGGGATGTTTTCGGTACTGTTCAGCGTGATGGTTCAAACGAACTTCTGCTGG
ACTACATCCGCCGCGCCCTGGAGCAGGGACATAACGACTACCCCATGATATCCGGGTATACCCGGTTTAT
GATCAACCCGGAAACCCGGGTCATCGCTGTCGATCTGAATAATGTTGCCGGTGACAAAACGCCTGCAGGC
AGGCTTAAAACCGGCATCATGTACCTGCTTGCAGGTCAGATCGCCGGTGGTGACTTCACCCTGCCACAAT
ACAGGGATGAAGTGTTAAAGCAGCTTCCACGGGAATACCATGAAATCGCTCTTAAACGTATTAACCAACT
TGATCAGGAGGTTAAGACAAAAGTTTATGATGAACTGCATAACGCCCGGGGCATTGACTTCATCTGGGAA
AATCTGGATACCCAGGAGCGTGAGCAACGCAAGTTTGCTATCCGCACGGTTCTGAGTACTCAGTATCTGA
GGGACTACCCGGAAAGTGTTCTTAAGTCAGCAAATACTCTCTGGTTACTGCGCTACAAACCCGAAGATAT
CCCCGTACTGAGGGATAACTTCAACGTGCCTGAATTTATGCTGAAACGCTTCCTGAAAATGCCGGAAGGC
CCGGCACCGGATGGTAGTGGTGTTCCTGTTCTGGGAGTATTCAGGGTAAAAAGTGGCACGCTTGCGAGAA
TACTCAAATTTACCGTCGGTCCACTGGAGCTATGGGCGCTGAACTCATCACCAAAAGACAGTGCCCTGCG
TAAAACGCTGACAAATAAGTTAGGTTCAGTTCGGGCACGTAAGATTCTGGCCGAAAACTTCCCCAGAGGT
TCTGCAACGTCATTAATTGAGCACCGGGCGGGCCAACATAACAGTGACAATGTTATTGAAGATCTGGCCT
CGGAGCTCATCCGAAAACAGGGATACAATCTCTGA
 Primer design