SecReT4
Protein ID: 256367596
T4SS name [ID]Tra_I [166]
Gene symboltraM
Locus tagpEK204_p64
StrainEscherichia coli plasmid pEK204 (NC_013120)
Repliconplasmid pEK204 [GenBank: NC_013120] [Browse all T4SS(s) in this replicon]
Location [Strand]61429..62121 [-]
ProductTraM protein
Component typeTraM_I
UniProt IDC7SA56
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 3.4e-34, Aligned region: 77..184
Protein Sequence: 230 a.a.     [Download]
>gi|256367596|ref|YP_003108155.1| TraM protein [Escherichia coli]
MTENTEPSSPSHPAPDPEILKSTIRAMKQSEQRANNVPALIKALLCTGTCLLISITGNAIQYWHSTNVER
EYFATDNGRLVRLAPTSQPAWSQNDAMAFGSQALATAFNLDFVHYRSQISSLSPRFSDEGFVGYVNALQA
SNILETIKKEKMNLTATTGAGVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPR
LKPSGMEIRQMISRNAGPNS
 
Nucleotide Sequence: 693 bp     [Download]
>gi|256367532|ref|NC_013120.1|:c62121-61429 Escherichia coli plasmid pEK204, complete sequence
ATGACCGAAAATACCGAGCCATCCTCGCCATCACATCCGGCACCTGACCCGGAAATACTGAAGAGCACAA
TCAGGGCTATGAAGCAGTCAGAACAGCGGGCAAATAATGTCCCTGCGCTGATAAAAGCGCTTTTATGTAC
GGGCACATGTCTTCTTATCAGTATTACTGGTAACGCCATTCAGTACTGGCACTCAACGAATGTGGAGCGC
GAATATTTCGCTACAGACAATGGTCGTCTGGTCAGGCTGGCACCAACAAGTCAGCCAGCATGGAGTCAGA
ATGATGCAATGGCCTTTGGCAGCCAGGCACTGGCGACCGCATTCAACCTGGATTTTGTGCACTATCGTTC
ACAGATCTCCTCCCTGTCTCCGCGTTTTTCTGACGAAGGTTTTGTCGGATATGTGAATGCATTACAGGCA
TCTAACATTCTGGAGACGATCAAGAAAGAGAAGATGAATCTGACCGCCACGACAGGTGCTGGCGTTCTGG
TACGACAGGGACAAATGTCCGACGGCGTATGGTTCTGGACATTCCAGTATCCTGTCCGTATGCGTCTGGT
CGGCCAGACAACCAGCAAGCCAGAACAGTCTTTTGTTTTCGAAATCACCATCCAGCGTGTTGACCCCAGA
CTGAAACCATCCGGTATGGAAATCCGGCAGATGATCTCCCGTAACGCCGGACCGAACTCCTGA
 Primer design