SecReT4
Protein ID: 256855334
T4SS name [ID]Tra_F [108]
Gene symboltraL
Locus tagpEC14_85
StrainEscherichia coli plasmid pEC14_114 (NC_013175)
Repliconplasmid pEC14_114 [GenBank: NC_013175] [Browse all T4SS(s) in this replicon]
Location [Strand]79801..80112 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB7LJ57, C8CGP9
KEGG IDeum:p1ECUMN_0110
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.2e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|256855334|ref|YP_003162578.1| conjugal transfer pilus assembly protein TraL [Escherichia coli]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGIITSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|256855249|ref|NC_013175.1|:79801-80112 Escherichia coli plasmid pEC14_114, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCATAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design