SecReT4
Protein ID: 256855350
T4SS name [ID]Tra_F [108]
Gene symboltraF
Locus tagpEC14_101
StrainEscherichia coli plasmid pEC14_114 (NC_013175)
Repliconplasmid pEC14_114 [GenBank: NC_013175] [Browse all T4SS(s) in this replicon]
Location [Strand]93709..94452 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDC8CGR5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.1e-78, Aligned region: 23..237
Protein Sequence: 247 a.a.     [Download]
>gi|256855350|ref|YP_003162594.1| conjugal pilus assembly protein TraF [Escherichia coli]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLTALQTATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKL
AEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|256855249|ref|NC_013175.1|:93709-94452 Escherichia coli plasmid pEC14_114, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGAAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCAGTACCTGCAGCCCCCCGTCA
GGAGCCGGACATTATGCAGAAACTGACCGCGCTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCTATT
CTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACTCAGCAGGCCGGGC
TTTTCACCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCCGAACTGGACTATAACCTGCAGTACAGCCA
TTACAACGGCACGGTCCGGAACCAGCTGGCGGCAGACCAGGCGCAGCAGCGACAGGCCATTGCGAAACTG
GCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGGACCCCATCGACGGGCAGCTGGCGCAGGTCA
TTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCGCT
GTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGTGTGAAATATTTCCCGGCCATGATG
CTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGCTTTATTTCACAGGACGACCTGGCAA
AACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAATTTTTAA
 Primer design