SecReT4
Protein ID: 256855352
T4SS name [ID]Tra_F [108]
Gene symboltraQ
Locus tagpEC14_103
StrainEscherichia coli plasmid pEC14_114 (NC_013175)
Repliconplasmid pEC14_114 [GenBank: NC_013175] [Browse all T4SS(s) in this replicon]
Location [Strand]95204..95488 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDB7LJ36, C8CGR7
KEGG IDeum:p1ECUMN_0088
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.4e-49, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|256855352|ref|YP_003162596.1| conjugal transfer pilin chaperone TraQ [Escherichia coli]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|256855249|ref|NC_013175.1|:95204-95488 Escherichia coli plasmid pEC14_114, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCACGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design