SecReT4
Protein ID: 257070293
T4SS name [ID]Trb [235]
Gene symboltrbF
Locus tagpW2_01
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]1310..2092 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDC7T544
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.9e-54, Aligned region: 46..258
Protein Sequence: 260 a.a.     [Download]
>gi|257070293|ref|YP_003162611.1| TrbF [Pseudomonas putida]
MSIADTLKGLIFKKPANSAEPRDPRRSKEPLAGGRRAGEAENPYLAARRTWNDHVGGVVSQRQTWQVIGI
LSLLIALAGVGGVIHIGSQSKFIPYVVEVDKLGQTVAAGPVQAAGKADPRVIHAAVADWMSCARMVSPDV
ALQRKCVFXGYSMLAPNDPATPKMNEWLNGTPDPAPSKRAEKEMVSVEIKTVIPQTPEAWQVEWVETTRD
RQGTLKGQPVTWRALVTTYIAEVTPNTTDEQLRNNPLSIYVRDYSWSRIQ
 
Nucleotide Sequence: 783 bp     [Download]
>gi|257070292|ref|NC_013176.1|:1310-2092 Pseudomonas putida plasmid pW2, complete sequence
ATGAGCATCGCCGACACCCTCAAGGGCTTGATCTTCAAGAAGCCCGCCAACTCCGCCGAGCCGCGCGATC
CGCGCCGCTCGAAGGAACCGCTCGCCGGCGGCCGCCGTGCGGGCGAGGCCGAGAACCCCTACCTGGCCGC
GCGCCGCACCTGGAACGATCACGTGGGCGGCGTCGTCTCGCAGCGCCAAACCTGGCAGGTGATCGGCATC
CTGTCGCTGTTGATCGCGCTGGCCGGCGTGGGTGGCGTGATCCACATCGGCAGCCAGTCGAAGTTCATCC
CCTACGTGGTCGAGGTGGACAAGCTGGGCCAGACGGTGGCCGCCGGCCCGGTGCAGGCCGCAGGGAAGGC
CGATCCGCGTGTCATCCACGCCGCCGTTGCGGACTGGATGAGCTGCGCGCGCATGGTGTCGCCTGACGTG
GCCTTGCAGCGCAAGTGCGTGTTCAANGGGTACTCGATGCTCGCCCCCAACGATCCGGCGACGCCAAAGA
TGAACGAGTGGTTGAACGGAACGCCCGATCCAGCCCCGTCCAAGCGCGCCGAGAAGGAAATGGTCAGCGT
CGAGATCAAGACCGTCATCCCGCAAACGCCCGAGGCCTGGCAAGTCGAGTGGGTGGAAACCACGCGCGAC
CGCCAAGGCACGCTGAAAGGTCAGCCCGTCACCTGGCGCGCGCTCGTGACTACCTACATCGCCGAGGTCA
CGCCCAACACCACCGATGAGCAACTGCGGAACAACCCGTTGAGCATCTACGTGCGTGATTACTCCTGGTC
CCGCATCCAATGA
 Primer design