SecReT4
Protein ID: 257070294
T4SS name [ID]Trb [235]
Gene symboltrbG
Locus tagpW2_02
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]2089..3009 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDC7T545
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.5e-66, Aligned region: 80..305
Protein Sequence: 306 a.a.     [Download]
>gi|257070294|ref|YP_003162612.1| TrbG [Pseudomonas putida]
MNSRSSTMKKTLSALIVGAAVAVPSLALAAPGDDIADKYFNKTNPTLTAQERAALAIAKRWEAGSATGIK
PVAGSGGAIKFVYGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGATEVQHLIIKP
MDVGLETSLVVTTNRRSYHFRLRSHRTEYMPQVSFTYPEEAQAKWDAIQRREKQERTDNTLPATGEYLGD
LSFDYELSGSASWKPVRVYNDGRKTIIEMPGTMQQTEAPTLLVVRKEGGLFTDDETVLVNYRVQGNRYIV
DTVFDRAILIAGVGSSQDRVTISRRK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|257070292|ref|NC_013176.1|:2089-3009 Pseudomonas putida plasmid pW2, complete sequence
ATGAATTCGAGGTCATCCACCATGAAGAAAACCCTCTCCGCTTTGATCGTGGGCGCTGCTGTGGCGGTGC
CCTCCCTGGCTCTGGCCGCCCCTGGCGACGACATTGCCGACAAGTATTTCAACAAGACCAACCCGACGCT
GACCGCTCAAGAGCGCGCGGCGCTCGCCATCGCCAAACGGTGGGAAGCGGGGTCGGCGACCGGCATCAAG
CCGGTGGCCGGCTCGGGCGGTGCCATCAAGTTCGTGTACGGCGCGCAGCAGCCGAGCATCGTTTGCGCGG
TGCTCCAGGTGTGCGACGTGGCCTTGCAGCCCGGCGAACAAGTGAACTCGATCAACCTGGGCGACACGGC
CAGGTGGACGGTGGAACCGGCCATCACCGGCAGCGGCGCGACCGAGGTTCAGCACCTCATCATCAAGCCG
ATGGACGTGGGCCTCGAAACCAGCCTGGTTGTGACCACGAACCGCCGCAGCTACCACTTCCGCCTGCGCT
CGCATCGCACCGAGTACATGCCGCAAGTCTCGTTCACGTACCCCGAGGAAGCGCAAGCCAAGTGGGACGC
GATCCAGCGCCGCGAGAAGCAGGAACGCACCGACAACACCCTGCCGGCGACGGGCGAGTACCTGGGCGAT
CTCTCGTTCGACTATGAGCTGTCCGGGTCGGCGAGCTGGAAGCCTGTGCGCGTCTACAACGATGGCCGCA
AGACCATCATCGAAATGCCCGGCACGATGCAGCAGACCGAAGCGCCGACGCTCCTGGTCGTGCGCAAAGA
GGGCGGCTTGTTCACCGACGACGAAACGGTGCTGGTCAATTACCGCGTGCAGGGCAATCGCTACATCGTG
GACACGGTGTTTGACCGCGCGATCCTGATTGCCGGTGTTGGCAGTAGCCAAGACCGCGTGACCATCAGCC
GGAGGAAGTGA
 Primer design