SecReT4
Protein ID: 257070295
T4SS name [ID]Trb [235]
Gene symboltrbH
Locus tagpW2_07
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]3012..3500 [+]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDC7T546
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 7.1e-49, Aligned region: 33..162
Protein Sequence: 162 a.a.     [Download]
>gi|257070295|ref|YP_003162613.1| TrbH [Pseudomonas putida]
MRKIVSLALLALALGLGGCATTSQYGNFVQSAALDQQKLATDAVQQLATLYAPARTRLELQQPTPDPFGQ
ALVKSLRDKGYALLEYAPAGASTQAPASAASQASAPATTAASGGLPLRYVLDQAGDSNLYRLTLMVGNQS
ITRPYLAQNGTFAPAGYWVRKE
 
Nucleotide Sequence: 489 bp     [Download]
>gi|257070292|ref|NC_013176.1|:3012-3500 Pseudomonas putida plasmid pW2, complete sequence
ATGCGCAAGATCGTCTCTCTCGCGCTGCTCGCCCTCGCCCTGGGCCTCGGCGGCTGCGCAACCACCAGCC
AGTACGGCAACTTCGTCCAGTCGGCCGCGCTCGATCAGCAGAAGCTCGCCACCGACGCGGTGCAGCAGCT
CGCCACGCTGTACGCGCCGGCGCGCACGCGCCTGGAGCTGCAACAGCCGACGCCCGATCCGTTCGGCCAG
GCGCTCGTCAAGTCGCTGCGCGACAAGGGCTATGCCCTCCTGGAGTACGCCCCGGCCGGCGCTTCCACGC
AGGCCCCGGCCTCGGCGGCATCGCAGGCGAGCGCACCGGCCACCACGGCCGCGTCGGGCGGCCTGCCGTT
GCGCTACGTGCTCGACCAGGCTGGCGACTCGAACCTGTACCGCCTGACCTTGATGGTCGGCAATCAATCC
ATCACCCGCCCTTACCTGGCGCAAAACGGCACGTTCGCGCCGGCCGGGTACTGGGTGCGCAAGGAGTGA
 Primer design