SecReT4
Protein ID: 257070296
T4SS name [ID]Trb [235]
Gene symboltrbI
Locus tagpW2_03
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]3505..4926 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDC7T547
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-65, Aligned region: 279..464
Protein Sequence: 473 a.a.     [Download]
>gi|257070296|ref|YP_003162614.1| TrbI [Pseudomonas putida]
MTENADQMAPDASPGEVSKKAGVRRVNNMPMYILGGVLLSFVLVMALVAADRAAKQNAPADGPKEKAGNT
SMFAKEIAGDKTGGLIEPASPLKVPDMPTGPASAPLEIARPSNPDAPPAPPANPGNPGQPVNDDEAQRIR
MAKMQMFGEAVKAKTTVRVDAPRSNGSAPGGPSTYTGTPQTRDEMLNRIAAVQQQIDAQRSNDPTAAYQA
RLAQIRGMGVGGGGAAPAAGGMGAGGAPQLLQTSTSGGGRNSMAQFGQGGQGDRWKLDSQPEAPRTPFEL
RAGFVVPATLISGINSDLPGQIMAQVAQDVYDTPTGKHLLIPQGSRLVGSYSSDVAYGQARVLVAWQRIV
FPDGKAMDIGAMPGADSAGYAGFHDQVNNHYVRLFGSAFLMSGVTAGITYSQRQNQATNTYGAPSASSAL
SEALGQQLGQVTAQLIAKNLSISPTLEIRPGYRFNVVVTKDMTFSKPYRSFDY
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|257070292|ref|NC_013176.1|:3505-4926 Pseudomonas putida plasmid pW2, complete sequence
ATGACAGAAAACGCCGATCAGATGGCACCTGACGCTTCGCCTGGCGAAGTGTCCAAGAAGGCGGGCGTCC
GTCGCGTCAACAACATGCCCATGTACATCCTCGGCGGCGTCCTGCTGTCGTTCGTGCTGGTCATGGCCCT
GGTCGCGGCGGATCGCGCGGCCAAGCAGAACGCGCCGGCGGACGGCCCCAAGGAGAAGGCCGGCAACACG
TCGATGTTCGCCAAGGAGATCGCAGGCGACAAGACCGGCGGCTTGATCGAGCCGGCAAGCCCGCTCAAGG
TGCCCGACATGCCGACCGGCCCGGCGTCGGCTCCGCTGGAGATCGCGCGGCCGTCCAACCCGGACGCGCC
GCCGGCCCCGCCGGCCAACCCCGGCAACCCGGGCCAGCCGGTGAACGACGACGAGGCCCAGCGCATCCGC
ATGGCGAAGATGCAGATGTTCGGCGAAGCCGTGAAGGCCAAGACCACCGTGCGCGTGGATGCCCCGCGTA
GCAACGGCTCCGCGCCGGGTGGCCCGAGCACCTACACCGGCACGCCGCAGACGCGCGATGAAATGCTGAA
CCGCATCGCAGCGGTGCAGCAGCAAATCGACGCGCAGCGCAGCAACGATCCGACCGCCGCCTATCAAGCA
CGCCTGGCGCAGATTCGCGGCATGGGCGTCGGTGGTGGCGGCGCGGCTCCGGCCGCCGGCGGCATGGGCG
CGGGCGGTGCGCCGCAGCTCCTGCAAACCTCGACCAGCGGCGGCGGGCGCAACAGCATGGCGCAGTTCGG
CCAAGGTGGGCAGGGCGACCGCTGGAAGCTGGATTCGCAGCCGGAAGCGCCGCGCACACCGTTCGAGCTG
CGCGCGGGCTTCGTCGTGCCGGCCACGCTCATTTCGGGCATCAACTCCGATCTGCCGGGCCAAATCATGG
CCCAGGTCGCGCAGGACGTGTACGACACACCGACCGGCAAGCACCTGTTGATCCCGCAGGGATCGCGCCT
CGTCGGCTCGTATTCGAGCGACGTGGCCTACGGCCAAGCGCGCGTGCTGGTTGCGTGGCAACGCATCGTG
TTCCCCGATGGCAAGGCGATGGACATTGGCGCGATGCCAGGCGCGGACAGCGCGGGATACGCGGGCTTCC
ACGACCAGGTGAACAACCACTATGTGCGCCTGTTCGGCTCGGCCTTCCTCATGTCCGGCGTGACAGCAGG
CATCACCTACAGCCAACGCCAGAACCAGGCCACAAACACCTATGGCGCACCGAGCGCCAGCAGTGCCCTA
AGCGAAGCCCTCGGCCAGCAGCTCGGCCAGGTTACGGCGCAACTCATCGCCAAGAACCTGAGCATTTCGC
CGACGCTGGAAATTCGGCCGGGGTATCGCTTCAACGTCGTGGTCACGAAGGACATGACGTTTTCCAAGCC
GTACCGTTCCTTCGATTACTAA
 Primer design