SecReT4
Protein ID: 257070297
T4SS name [ID]Trb [235]
Gene symboltrbJ
Locus tagpW2_04
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]4947..5711 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDC7T548
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|257070297|ref|YP_003162615.1| TrbJ [Pseudomonas putida]
MKPKFLAAKLALVIAVSSTLAVTPVQAGIPVIDGTNLSQNIMTAIESVAQTLKQIEQYSTQLQQYQNQLQ
NTMAPAAYIWDQAQSTINGLMNAVNTLDYYKTQLGSLDSYIGKFQDVNYYKNSPCFTAAGCSDAERAALR
NVAQLASESQKKANDALFKGLDRQQTNLTADAATLQRLQSAAQGAQGQMQAIGYANQLASQQANQLLQIR
GLLIAQQNAMATKMQADADKEAQQAAAAAQLRQGSYRASPARTW
 
Nucleotide Sequence: 765 bp     [Download]
>gi|257070292|ref|NC_013176.1|:4947-5711 Pseudomonas putida plasmid pW2, complete sequence
ATGAAGCCGAAGTTTTTAGCCGCTAAATTGGCCCTCGTCATTGCTGTTTCGAGCACGCTGGCGGTCACAC
CTGTGCAGGCTGGCATCCCCGTCATCGACGGCACCAACCTGTCGCAGAACATCATGACGGCCATCGAATC
GGTGGCCCAGACGCTCAAGCAAATTGAGCAGTACAGCACCCAGCTCCAGCAGTATCAAAACCAACTCCAG
AACACGATGGCCCCGGCCGCGTATATCTGGGATCAGGCGCAATCGACCATCAACGGGTTGATGAACGCGG
TCAACACGCTGGATTACTACAAGACCCAACTCGGCAGCCTGGACAGCTACATCGGCAAGTTCCAGGACGT
GAACTACTACAAGAACTCGCCGTGCTTTACGGCGGCAGGGTGCTCCGACGCGGAACGCGCAGCACTTCGG
AATGTGGCCCAGCTCGCGAGCGAGTCGCAGAAGAAGGCCAACGATGCCTTGTTCAAGGGCCTCGATAGGC
AGCAAACGAATCTCACGGCCGATGCAGCGACGTTGCAGCGTCTTCAATCGGCAGCGCAGGGCGCGCAGGG
CCAAATGCAGGCCATCGGCTACGCCAACCAGCTCGCCAGCCAGCAGGCCAACCAGCTCTTGCAGATTCGT
GGCCTGCTGATCGCGCAGCAGAACGCGATGGCAACCAAGATGCAGGCCGACGCCGACAAGGAAGCCCAGC
AGGCGGCAGCGGCCGCACAACTGCGCCAGGGCAGCTACCGGGCCAGCCCGGCGCGCACCTGGTAA
 Primer design