SecReT4
Protein ID: 257070298
T4SS name [ID]Trb [235]
Gene symboltrbK
Locus tagpW2_05
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]5721..5948 [+]
ProductTrbI
Component typeTrbK
UniProt IDC7T549
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|257070298|ref|YP_003162616.1| TrbI [Pseudomonas putida]
MKAIKALSLASAALVAALVAGCDNKPATAPMPEVNDENCKPENIAKIEDKGVQQAFSSLCLRRGGDFKPS
PKREW
 
Nucleotide Sequence: 228 bp     [Download]
>gi|257070292|ref|NC_013176.1|:5721-5948 Pseudomonas putida plasmid pW2, complete sequence
ATGAAAGCAATCAAGGCTCTGTCCTTGGCCTCGGCCGCCCTCGTGGCGGCCTTGGTCGCCGGCTGCGACA
ACAAGCCGGCCACGGCCCCCATGCCGGAAGTGAACGACGAGAACTGCAAGCCCGAGAACATCGCCAAGAT
CGAGGACAAGGGCGTCCAGCAGGCTTTTTCGTCGCTGTGCTTGCGTCGTGGTGGGGATTTCAAGCCCAGC
CCGAAACGCGAATGGTGA
 Primer design