SecReT4
Protein ID: 257070299
T4SS name [ID]Trb [235]
Gene symboltrbL
Locus tagpW2_06
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]5959..7677 [+]
ProductTrbL
Component typeTrbL
UniProt IDC7T550
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.8e-37, Aligned region: 67..279
Protein Sequence: 572 a.a.     [Download]
>gi|257070299|ref|YP_003162617.1| TrbL [Pseudomonas putida]
MRMPANLKTLALPLFVWLAFFAVDAHAAIDNAGVFDSVLDRYQAAASGWAGVITTAATWLFWTLVVMCWV
GTFGMMALRKADIGEFFAEFVRFTIFTGFFWWALTNGPNFASSIYASLRQLAGNATGLGNALSPSGIVDV
GFAIFDKVMDQSSVWSPVDSMAGILMAVAILVILALVGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKVVLGVAAQLFAMVLLVGIGKTFLDDYYSRMSAGISLKEMGVMLIVVIILLALVNKIPPLIAGII
TGASVGGAGIGQFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSAGTDVMSA
FSGGGSSGGGAGGGGDAGTGSTPFAQAAGFSGSSGGGSSSGGGSPSTGSSSGSSKGGDKGGGKADAGGQG
SSSTASTGSSADKAAKNEPKPAGGAGQGQQAAPGSTGPGLLASAASALGTAGRIAADAGANLAKGTADVA
KAKAASLREAAAERIADTTGGKIAAAIKAQGSGTAENIDVPDQQPAPSFGDNSLAGGPADADPESEVAAF
ANREQGRDGTTA
 
Nucleotide Sequence: 1719 bp     [Download]
>gi|257070292|ref|NC_013176.1|:5959-7677 Pseudomonas putida plasmid pW2, complete sequence
ATGAGAATGCCAGCCAATCTAAAAACCCTCGCCCTGCCGCTGTTCGTCTGGCTGGCGTTCTTCGCGGTCG
ATGCCCACGCGGCCATCGACAACGCCGGCGTGTTCGATAGCGTGCTGGATCGCTACCAGGCCGCCGCGAG
CGGCTGGGCCGGTGTCATCACCACGGCCGCAACCTGGCTCTTCTGGACGCTGGTTGTGATGTGTTGGGTC
GGTACTTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGTTCGTCCGCTTCA
CGATCTTTACCGGCTTCTTCTGGTGGGCGCTGACCAACGGCCCTAACTTCGCCTCGTCCATCTATGCGTC
GTTGCGGCAGCTCGCCGGCAACGCGACGGGCCTGGGCAATGCTCTGTCGCCCTCGGGCATCGTGGACGTG
GGCTTTGCGATCTTCGACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TCCTCATGGCCGTGGCGATCCTGGTCATCCTGGCCCTGGTCGGTGTGAATATGCTTCTGCTGCTCGCGTC
GGGCTGGGTGCTCGCCTACGGCGGCGTGTTCTTCCTCGGCTTCGGTGGTTCGCGCTGGACTTCCGACATG
GCGATCAACTACTACAAGGTCGTCCTGGGCGTGGCCGCGCAGCTCTTCGCAATGGTGCTCCTGGTGGGCA
TCGGCAAGACCTTCCTCGATGACTACTACTCGCGCATGAGCGCCGGCATCAGCCTCAAGGAAATGGGCGT
GATGCTGATCGTCGTCATCATCCTCTTGGCGTTGGTCAACAAGATTCCGCCGCTCATCGCCGGGATCATC
ACCGGCGCGAGCGTGGGCGGTGCCGGCATCGGCCAGTTCGGTGCAGGCGCTGCGTTGGGTGCCGCAGGCA
TGGCAGCAGCAGCGGCCGCGACCGGCGGCGCCGCTCTGGCCGCCGGCGCAGCCTCGGCCGCCGGTGGTGC
CTCTGCCGTCATGGCCGCCTTCTCGAAGGCCAATGAGAACGTGTCGGCAGGCACGGACGTTATGTCGGCC
TTCTCGGGCGGCGGCAGCTCGGGCGGCGGTGCGGGCGGCGGCGGCGACGCCGGCACCGGCAGCACGCCCT
TCGCTCAGGCTGCGGGCTTTAGCGGCAGCTCCGGCGGTGGCTCTTCGTCGGGTGGCGGCAGCCCCTCGAC
CGGCAGCAGCTCGGGCAGCTCGAAGGGCGGCGATAAGGGCGGCGGCAAAGCCGACGCCGGCGGCCAGGGC
AGCAGCTCGACGGCCAGCACCGGCAGCAGTGCCGACAAGGCCGCCAAGAACGAACCCAAGCCCGCCGGCG
GGGCAGGGCAAGGGCAGCAGGCCGCACCGGGCAGCACCGGCCCCGGCTTGCTCGCATCGGCCGCATCGGC
CCTCGGCACGGCCGGCCGCATCGCCGCCGACGCCGGCGCGAACTTGGCGAAGGGAACCGCCGATGTTGCC
AAGGCCAAAGCCGCGAGCCTGCGCGAAGCCGCAGCCGAGCGGATCGCCGACACCACTGGCGGAAAGATCG
CCGCCGCGATCAAGGCGCAAGGAAGCGGCACGGCCGAGAACATCGACGTGCCCGACCAGCAGCCCGCGCC
GAGCTTCGGCGACAACAGCCTGGCAGGCGGCCCCGCCGATGCCGATCCCGAGTCCGAAGTAGCTGCGTTC
GCCAACCGCGAGCAAGGCCGCGACGGCACAACTGCGTAA
 Primer design