SecReT4
Protein ID: 257070301
T4SS name [ID]Trb [235]
Gene symboltrbN
Locus tagpW2_09
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]8296..8931 [+]
Productconjugal transfer protein TrbN
Component typeTrbN
UniProt IDC7T552
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 211 a.a.     [Download]
>gi|257070301|ref|YP_003162619.1| TrbN [Pseudomonas putida]
MPFFADLPPQLQERVVCSISAAVKYEVPVNIVLAVAEKEGGKPGQWVRNSNGTHDVGPMQFNTAYLGDLA
RYGITANDVAAAGCYSFDLAAWRLRMHIRNDKGDLWTKAANYHSRTPQYNAVYRADLMRKASKWADWLEA
RFVTLDVTKAGATPSTPSQPATVAQRATPAARPAPAPQQAAPAAAAARSVSVAGYVPRTVSFNTSREGSA
E
 
Nucleotide Sequence: 636 bp     [Download]
>gi|257070292|ref|NC_013176.1|:8296-8931 Pseudomonas putida plasmid pW2, complete sequence
ATGCCGTTCTTCGCCGATCTGCCGCCGCAGCTCCAGGAGCGCGTCGTCTGCTCGATCTCGGCCGCCGTCA
AGTACGAGGTGCCGGTCAACATCGTGTTGGCCGTCGCCGAGAAAGAGGGCGGCAAGCCGGGCCAGTGGGT
GCGCAACTCGAATGGCACGCATGACGTTGGCCCGATGCAGTTCAACACCGCGTACCTGGGCGACCTGGCC
CGATACGGCATCACGGCGAACGATGTGGCGGCTGCCGGCTGCTACTCGTTCGACCTGGCCGCCTGGCGGC
TGCGGATGCACATCCGCAACGACAAGGGCGACCTCTGGACGAAGGCGGCGAACTACCACTCGCGCACGCC
GCAGTACAACGCGGTGTACCGGGCCGACTTGATGCGCAAGGCGTCGAAGTGGGCCGATTGGCTCGAAGCT
CGGTTCGTCACGCTTGACGTGACGAAGGCCGGGGCCACGCCCTCGACGCCCAGCCAGCCCGCGACGGTGG
CCCAGCGGGCGACGCCGGCGGCCAGGCCGGCACCAGCACCCCAGCAGGCCGCCCCAGCGGCCGCAGCAGC
TCGCAGCGTGTCGGTGGCCGGCTACGTGCCCCGCACGGTGTCTTTCAACACTTCACGCGAGGGGTCGGCC
GAGTAG
 Primer design