SecReT4
Protein ID: 257070311
T4SS name [ID]Trb [235]
Gene symboltraF
Locus tagpW2_16
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]19890..20426 [-]
Productconjugal transfer peptidase TraF
Component typeTraF
UniProt IDC7T562
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.7e-45, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|257070311|ref|YP_003162629.1| TraF [Pseudomonas putida]
MSRILKRIAAGVVIAGVAALLLAAGGYAAGARVNTTKSIPVGLYWTSSAPVEKGAYVLFCPPQLGVFDDA
KERGYIGAGFCQGGYGYMMKRVLAAKDDAVAVADDGVRVNGELLPLSAPIKADKAGRPLPRYQSNSYTLG
NSEVLLMSDVSATSFDGRYFGPINRSQIKTVIRPVITW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|257070292|ref|NC_013176.1|:c20426-19890 Pseudomonas putida plasmid pW2, complete sequence
ATGAGCCGCATCCTGAAACGCATCGCGGCAGGCGTCGTCATCGCGGGCGTGGCCGCCCTGCTGCTGGCCG
CCGGCGGCTATGCCGCCGGTGCCCGCGTGAACACCACCAAGAGCATTCCGGTCGGCCTGTACTGGACGAG
CAGCGCGCCGGTGGAGAAGGGGGCCTACGTCCTCTTCTGCCCGCCGCAGCTCGGCGTGTTCGATGACGCC
AAGGAGAGGGGCTACATCGGGGCCGGCTTCTGCCAGGGCGGCTACGGCTACATGATGAAGCGCGTTTTAG
CCGCTAAAGACGATGCCGTCGCCGTCGCCGATGACGGCGTGCGCGTCAACGGCGAGCTGCTGCCCCTCAG
CGCGCCGATCAAGGCCGACAAGGCCGGTCGGCCGCTGCCGCGCTATCAGTCCAACAGCTACACGCTCGGC
AATTCCGAGGTGCTGCTTATGTCGGACGTGAGCGCCACATCCTTCGACGGCCGCTACTTCGGCCCGATCA
ATCGTTCGCAAATCAAGACCGTGATCCGTCCGGTCATCACCTGGTAG
 Primer design