SecReT4
Protein ID: 257070312
T4SS name [ID]Trb [235]
Gene symboltraG
Locus tagpW2_17
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]20423..22336 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDC7T563
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.8e-162, Aligned region: 121..620
TraG-D_C [PF12696], Evalue: 1.9e-32, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 1.5e-26, Aligned region: 177..568
Protein Sequence: 637 a.a.     [Download]
>gi|257070312|ref|YP_003162630.1| TraG [Pseudomonas putida]
MKIKMNNAVGPQVRTAKPKPSKLLPVLGAASMVGGLQAATQFFAHTFAYHATLGPNVGHVYAPWSILHWT
YKWYSQYPDEIMKAGSMGMLVSTVGLLGVAVAKVVTSNSSKANEYLHGSARWAEKKDIQAAGLLPRERNV
LEIVTGKAAPTATGVYVGGWQDKDGNFFYLRHSGPEHVLTYAPTRSGKGVGLVVPTLLSWGASSVITDLK
GELWALTAGWRQKHAKNKVLRFEPASTSGGVCWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLDSHWQ
KTAFALLVGVILHALYKAKDDGGTATLPSVDAMLADPNRDIGELWMEMATYGHVDGQNHHAIGSAARDMM
DRPEEEAGSVLSTAKSYLALYRDPVVARNVSRSDFRIKQLMHEDDPVSLYIVTQPNDKARLRPLVRVMVN
MIVRLLADKMDFEGGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQDINQLKSRET
GYGHDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRTAAMLGQVSRTYQEVQRPLLT
PDECLRMPGPKKNAQGEIEEAGDMVIYVAGYPAIYGKQPLYFKDPVFSARAAIPAPKVSDRLRAVAQAET
EGEGITI
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|257070292|ref|NC_013176.1|:c22336-20423 Pseudomonas putida plasmid pW2, complete sequence
ATGAAGATCAAGATGAACAACGCGGTAGGGCCGCAAGTCCGAACCGCCAAACCGAAGCCGAGCAAGCTGC
TGCCGGTGCTGGGCGCGGCCTCGATGGTCGGCGGCCTCCAGGCCGCGACGCAGTTCTTCGCCCACACGTT
CGCCTATCACGCGACCCTCGGCCCCAACGTGGGCCACGTGTACGCGCCCTGGTCGATCCTGCACTGGACG
TACAAGTGGTACAGCCAGTACCCGGACGAGATCATGAAGGCCGGCAGCATGGGGATGCTGGTTTCGACCG
TGGGCCTGCTGGGCGTGGCCGTGGCGAAGGTCGTCACGTCCAACAGCTCGAAGGCGAACGAGTACCTGCA
CGGCTCGGCCCGCTGGGCCGAGAAGAAGGACATTCAGGCGGCCGGCCTGCTGCCACGCGAGCGCAACGTC
CTGGAGATCGTCACCGGCAAGGCCGCACCCACGGCTACCGGCGTGTACGTGGGCGGCTGGCAGGACAAGG
ACGGCAATTTCTTCTACCTGCGGCACAGCGGCCCCGAGCACGTGCTGACCTACGCGCCCACGCGCTCGGG
CAAGGGCGTCGGCCTGGTGGTGCCCACGCTGCTGTCGTGGGGCGCGAGCAGCGTCATCACCGACTTGAAG
GGCGAGTTGTGGGCCTTGACCGCCGGCTGGCGGCAGAAGCACGCCAAGAACAAGGTGCTGCGCTTCGAGC
CGGCCAGCACCTCGGGCGGCGTCTGCTGGAATCCGCTGGACGAAATCCGCCTCGGCACCGAATACGAGGT
GGGTGACGTGCAGAACCTTGCCACGCTGATCGTTGACCCGGACGGCAAGGGCCTGGACTCGCACTGGCAG
AAGACCGCCTTCGCGCTCCTGGTCGGCGTGATCCTGCACGCGCTGTACAAGGCCAAGGACGATGGCGGCA
CCGCCACGCTGCCGTCCGTCGATGCGATGCTGGCCGACCCGAACCGGGACATTGGCGAGCTTTGGATGGA
AATGGCGACCTACGGGCACGTAGACGGCCAGAACCATCACGCCATCGGCTCGGCGGCCCGCGACATGATG
GATCGGCCCGAGGAAGAAGCCGGATCGGTGCTGTCCACGGCCAAGTCGTACCTGGCCCTGTACCGCGACC
CCGTGGTGGCCCGCAACGTCAGCCGGTCGGACTTCCGCATCAAGCAGTTGATGCACGAGGACGACCCGGT
AAGCCTCTACATCGTCACCCAGCCCAACGATAAGGCCCGCCTGCGGCCGCTGGTGCGCGTCATGGTGAAC
ATGATCGTGCGCCTGCTGGCCGACAAGATGGACTTCGAGGGCGGCCGGCCGGTGGCGCACTACAAGCACC
GGCTCTTGATGATGCTGGACGAGTTCCCGAGCCTCGGGAAGCTGGAGATCATGCAAGAGTCGCTGGCCTT
CGTGGCCGGCTACGGCATCAAGTGCTACCTCATCTGCCAGGACATTAACCAGCTCAAGAGCCGCGAGACG
GGCTACGGCCACGACGAAAGCATCACGTCGAACTGCCACGTGCAGAACGCCTACCCGCCCAACCGCGTCG
AGACGGCCGAACACCTGTCCCGCCTCACCGGGCAGACCACCGTGGTGAAGGAGCAGATCACGACCAGCGG
CCGCCGCACGGCGGCGATGCTGGGCCAGGTGTCGCGCACTTACCAGGAAGTGCAGCGGCCCTTGCTGACG
CCCGACGAATGCCTGCGCATGCCGGGGCCAAAGAAGAACGCCCAGGGCGAGATCGAAGAAGCCGGCGACA
TGGTGATCTACGTCGCGGGCTACCCGGCGATCTACGGCAAGCAACCCCTGTACTTCAAAGACCCAGTGTT
CTCGGCACGCGCCGCGATCCCTGCGCCCAAGGTCAGCGACCGCCTGCGCGCCGTCGCACAGGCCGAGACG
GAAGGGGAGGGCATCACGATATGA
 Primer design