SecReT4
Protein ID: 257070360
T4SS name [ID]Trb [235]
Gene symboltrbC
Locus tagpW2_37
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]74472..74936 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDC7T5B2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-18, Aligned region: 12..110
Protein Sequence: 154 a.a.     [Download]
>gi|257070360|ref|YP_003162679.1| TrbC [Pseudomonas putida]
MQATFPAFRLNRNALFYMGLFALLAFFLLAPQHAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGALHQVKVAALDVAGFPG
EAVMRWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|257070292|ref|NC_013176.1|:74472-74936 Pseudomonas putida plasmid pW2, complete sequence
ATGCAAGCAACCTTCCCGGCATTCCGCCTCAACCGCAACGCCCTGTTCTACATGGGCCTCTTCGCCCTCC
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCATTCGCCTCCGAGGGCACCGGCGGCTCTCTGCCGTATGA
GAGCTGGCTGACCAACCTCCGCAACTCCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTGGTCGCCGGCGGCATCCTCATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAGAACATGATGAGCACGTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGCGCTGCACCAGGTCAAGGTCGCCGCGCTGGACGTGGCCGGCTTCCCCGGC
GAAGCCGTCATGCGCTGGGCCGAGCGCGGCCACATCGCGGGGTAA
 Primer design