SecReT4
Protein ID: 257070361
T4SS name [ID]Trb [235]
Gene symboltrbD
Locus tagpW2_38
StrainPseudomonas putida plasmid pW2 (NC_013176)
Repliconplasmid pW2 [GenBank: NC_013176] [Browse all T4SS(s) in this replicon]
Location [Strand]74940..75251 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDC7T5B3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.6e-26, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|257070361|ref|YP_003162680.1| TrbD [Pseudomonas putida]
MALRAIPIRRAGNRENLFMGGDRELVMFSGLLAGALIFSAQEVRATVFGIALWFGALFALRLMAKADPKL
RHVYLRHRRYKPYYPARSTPFRDNTPSQGKQYK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|257070292|ref|NC_013176.1|:74940-75251 Pseudomonas putida plasmid pW2, complete sequence
ATGGCTCTGCGCGCGATCCCCATCCGTAGGGCCGGCAACCGAGAAAACCTGTTCATGGGCGGGGATCGTG
AGCTGGTGATGTTCTCGGGCCTGCTGGCCGGCGCGCTGATTTTCAGCGCCCAAGAAGTGAGGGCAACGGT
GTTCGGCATCGCCTTGTGGTTCGGCGCGCTCTTCGCGCTGCGCCTCATGGCGAAGGCCGATCCGAAGCTG
CGACACGTGTACCTGCGGCACCGCCGATACAAGCCGTACTACCCGGCTCGCAGCACGCCCTTCCGTGACA
ACACGCCGAGTCAAGGGAAGCAATACAAATGA
 Primer design