SecReT4
Protein ID: 257091575
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4641
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]76633..78543 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDC7RVW1
KEGG IDapp:CAP2UW1_4641
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-155, Aligned region: 121..614
TraG-D_C [PF12696], Evalue: 6.6e-32, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 1.4e-28, Aligned region: 176..568
Protein Sequence: 636 a.a.     [Download]
>gi|257091575|ref|YP_003165218.1| hypothetical protein CAP2UW1_4641 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MKDQFNNAVGPQVRGSTPKAGKLIPALVVVSLAAGLQSATQFFAHDFGYQAALGRHFEHLYVPWSILQWA
GQWYGQYPEAIMRAGSVGMIVTTLGLLGLAVSRMVLANSSRLNPYLHGSARWANLKDIQASGLLPRPRTF
WQALTGARPAASAGVYVGAWLDPRGHSHYLRHNGPEHVLCYAPTRSGKGVGLVVPTLLSWGESAVITDLK
GELWALTAGWRRQHAKNQVLRFEPAAASGSVCWNPLDEIRIGTEHEVGDVQNLATLIVDPDGRGLESHWQ
KTSQALLVGVILHALYKAANEGTAATLPAVDALLADPDRDVAELWMEMRTYGHLDGQNHPAVGSAARDMM
DRPDEEAGSVLSTAKSYLAVYRDPVVARNVSKSEFRIRDLMHHAQPVSLYILTQPNDKTRLRPLVRVMVS
MIVHLLADKLHFENGRPVAHYRHRLLMMLDEFPSLGKLEILQESLAFVAGYGIKCYLVCQDINQLKSRET
GYGHDESITSNCHVQNAYPPNRVETAEHLSKLTGQTTVAKEQITTSGRRASALLGQVSRTIQEVQRPLLT
PDECLRMPGPIKNAHGDIEEAGDMVVYVAGYPAIYGKQPLYFKDPIFQARAAIPAPQDSDKLIHVHDVPA
GEGITL
 
Nucleotide Sequence: 1911 bp     [Download]
>gi|257091505|ref|NC_013193.1|:76633-78543 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGAAAGACCAGTTCAACAACGCCGTCGGACCCCAGGTGCGAGGATCGACGCCGAAGGCCGGCAAGCTCA
TCCCGGCGTTGGTCGTGGTTTCCCTGGCGGCCGGCCTGCAATCCGCCACCCAGTTCTTCGCGCACGATTT
CGGCTACCAGGCGGCACTGGGCCGTCACTTCGAGCACCTGTATGTGCCGTGGTCGATCCTGCAATGGGCT
GGCCAGTGGTACGGGCAGTACCCGGAGGCGATCATGCGCGCCGGCAGCGTCGGCATGATCGTCACCACCC
TGGGCCTGCTCGGCCTGGCGGTTAGCCGGATGGTCCTGGCCAACTCGTCCCGGCTGAACCCTTACCTGCA
CGGTTCGGCCCGCTGGGCCAACCTGAAGGACATCCAGGCGTCTGGCCTGCTGCCCCGGCCGCGAACGTTC
TGGCAGGCGCTCACCGGCGCCCGGCCGGCGGCCAGTGCCGGCGTCTATGTCGGTGCCTGGCTGGACCCGC
GGGGTCATTCGCATTACCTGCGCCACAACGGCCCGGAGCATGTCCTGTGCTACGCGCCGACCCGTTCCGG
CAAGGGCGTCGGCCTGGTGGTGCCGACCCTCCTGTCGTGGGGCGAGAGCGCCGTCATCACCGACCTGAAG
GGCGAGCTCTGGGCCTTGACCGCCGGCTGGCGCCGGCAGCACGCGAAAAACCAGGTGCTGCGCTTCGAGC
CCGCCGCGGCCAGCGGCAGCGTCTGCTGGAACCCTCTGGACGAAATCCGCATCGGCACCGAGCACGAGGT
TGGCGACGTGCAGAATCTCGCCACGCTGATCGTCGACCCGGACGGCCGCGGCCTGGAATCACACTGGCAG
AAAACCAGCCAGGCGCTGCTGGTCGGCGTCATCCTGCACGCGCTCTACAAGGCCGCCAACGAGGGCACGG
CGGCCACCCTGCCGGCCGTCGATGCCCTGCTGGCCGATCCAGACCGCGATGTCGCCGAGCTCTGGATGGA
GATGCGCACCTACGGCCACCTTGACGGCCAGAACCATCCGGCCGTCGGATCGGCCGCCCGCGACATGATG
GATCGCCCCGACGAAGAAGCCGGGTCGGTCCTGTCCACGGCCAAGTCGTACCTGGCGGTGTACCGCGATC
CCGTCGTCGCGCGCAACGTCAGCAAGTCCGAATTCAGGATCCGGGACCTGATGCACCACGCGCAGCCGGT
CAGCCTGTACATCCTCACCCAGCCGAACGACAAGACCCGTCTGCGGCCGCTGGTGCGCGTCATGGTCAGC
ATGATCGTCCACCTCCTGGCCGATAAGCTGCACTTCGAGAACGGCCGGCCGGTCGCCCACTACCGGCACC
GCCTGCTGATGATGCTCGACGAGTTCCCCAGCCTGGGGAAACTCGAAATCCTGCAGGAGTCGCTGGCCTT
CGTCGCCGGCTACGGGATCAAGTGCTACCTGGTCTGCCAGGACATCAACCAGCTCAAGAGCCGCGAAACC
GGCTACGGCCACGACGAAAGCATCACCTCGAACTGCCACGTGCAGAACGCCTACCCGCCGAACCGGGTAG
AGACCGCCGAGCACCTTTCCAAACTGACCGGGCAAACCACCGTCGCCAAGGAGCAGATCACCACCAGCGG
CCGGCGCGCGAGCGCCTTGCTGGGGCAGGTGTCGCGCACCATCCAGGAGGTGCAGCGCCCGCTGCTGACC
CCGGACGAGTGTCTGCGCATGCCGGGCCCGATCAAGAACGCCCACGGCGACATCGAAGAAGCCGGCGACA
TGGTCGTGTACGTTGCCGGCTATCCCGCGATCTACGGCAAGCAGCCGCTCTACTTCAAGGACCCGATATT
CCAGGCCCGCGCCGCGATCCCGGCACCGCAGGACAGCGACAAGCTGATCCACGTCCACGACGTGCCGGCA
GGGGAGGGCATCACTCTATGA
 Primer design