SecReT4
Protein ID: 257091576
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4642
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]78540..79076 [+]
Productconjugal transfer peptidase TraF
Component typeTraF
UniProt IDC7RVW2
KEGG IDapp:CAP2UW1_4642
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.1e-41, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|257091576|ref|YP_003165219.1| hypothetical protein CAP2UW1_4642 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MNRLLRRLAVGTAIAGAAILALGALAYASGARINSTKSIPVGLYWLSSEPVEKGAYVMFCPPPIGVFEDA
RARGYVGAGFCPGGYGYLMKRVLAAKGDAVTISDEGVRVNGELLPHSTPIRADSNGRPLLRFPAGRFTLD
GSELLLMSDVSGTSFDGRYFGPIHRSQIKGVIRAVFTW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|257091505|ref|NC_013193.1|:78540-79076 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGAACCGCCTGCTGCGACGCCTTGCCGTGGGTACCGCCATCGCCGGCGCCGCGATCCTGGCGCTGGGTG
CGCTCGCCTATGCCAGTGGTGCCCGCATCAACAGCACCAAGAGCATCCCGGTTGGGCTGTACTGGCTGAG
CAGCGAGCCGGTGGAGAAGGGCGCTTACGTGATGTTCTGCCCACCGCCCATCGGCGTCTTCGAGGACGCC
AGGGCCAGGGGTTACGTTGGGGCCGGCTTCTGTCCGGGCGGGTACGGTTACCTGATGAAGCGCGTCCTGG
CCGCCAAAGGCGACGCCGTCACCATCAGCGATGAAGGTGTGCGCGTGAACGGCGAGCTGCTGCCGCACAG
TACCCCGATCCGGGCCGACAGCAACGGCCGGCCCCTGCTGCGCTTTCCGGCCGGGCGCTTCACGCTGGAC
GGTTCCGAACTGCTGCTGATGTCGGATGTCAGCGGCACGTCCTTCGATGGCCGCTACTTCGGCCCGATCC
ACCGTTCGCAGATCAAGGGCGTGATCCGCGCTGTTTTTACCTGGTAA
 Primer design