SecReT4
Protein ID: 257091647
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4720
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]152725..152988 [-]
Producthypothetical protein
Component typeTrbN
UniProt IDC7RW33
KEGG IDapp:CAP2UW1_4720
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 87 a.a.     [Download]
>gi|257091647|ref|YP_003165290.1| hypothetical protein CAP2UW1_4720 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MPVADLPPQLQERVVCSIAAAVKYQVPANIVFAVAEKEGGKPGQWVRNSNGTHDVGPMQFNTAYLRDLAR
YGITPDDVAGVASENGK
 
Nucleotide Sequence: 264 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c152988-152725 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGCCTGTTGCCGATCTTCCGCCCCAGCTTCAGGAGCGCGTCGTCTGCTCGATCGCGGCCGCTGTGAAGT
ACCAAGTTCCCGCGAACATCGTGTTTGCGGTGGCGGAGAAGGAAGGGGGGAAGCCGGGCCAGTGGGTGCG
CAACTCCAACGGCACGCATGACGTGGGGCCGATGCAATTCAACACGGCGTACCTGCGCGACTTAGCTCGC
TACGGCATCACGCCGGATGATGTAGCAGGGGTCGCCTCAGAAAACGGAAAATAA
 Primer design