SecReT4
Protein ID: 257091649
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4722
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]153606..155132 [-]
Producthypothetical protein
Component typeTrbL
UniProt IDC7RW35
KEGG IDapp:CAP2UW1_4722
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.9e-36, Aligned region: 65..279
Protein Sequence: 508 a.a.     [Download]
>gi|257091649|ref|YP_003165292.1| hypothetical protein CAP2UW1_4722 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MSLPTVLKSASITMLLWLAFFSIDAQAAINNAGVLDNVLARYAAAASAWAGVITARASFLFWTLAVISMV
WTFGMLALRKADLGDFYAEFFRFTVFTGFFWWLLTNGPRFATDIMDSLRTLGGMATGTGATLTPSGIVDI
GFDIFFKVLDKSSILSPVDSAVGILISAAILIILALIGVNMLVLLVSGWILSYAGVFFLGFGGSRWTSDM
AIGYYKTVLNIAAQLFTMVLLVGIGKSFVDQYYAGMDPGISLKELGVMLIVAVVLFALVTKLPSLIGGLA
MGGSVHTMGSGLGTGAAMAAVGMASAAVGVAGAAIATGAASMAGGTQALMAACSKASQDVAGGSDMLASL
AGGSSSGAGRSSAGSGASPLAAAMDSSSAGGGPSGGSSSHSGRSDTRQASAKRGGTPGQAQSGDMASVVA
KVGKVVAGTAANLAQGSWDVAKARAGEVKDAAMDRIGETTGGKIAAAIKARSDQQPAFGSDSLAKADDQS
VDAEAEIAAFRDRAARSS
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c155132-153606 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGAGCCTGCCCACCGTACTCAAGAGCGCCAGTATTACGATGCTATTGTGGCTGGCGTTTTTCTCCATCG
ACGCCCAGGCAGCGATCAACAATGCGGGTGTCCTCGACAACGTCCTGGCGCGCTATGCGGCTGCGGCCAG
CGCCTGGGCAGGCGTCATCACGGCGCGAGCCAGCTTCCTGTTCTGGACGCTCGCCGTGATCTCGATGGTC
TGGACCTTCGGCATGCTGGCCTTGCGCAAAGCTGACCTGGGTGACTTCTACGCCGAGTTCTTCCGGTTCA
CGGTGTTCACCGGCTTCTTCTGGTGGTTGCTCACCAACGGCCCGCGCTTCGCTACCGACATCATGGATTC
CCTACGCACCCTCGGCGGCATGGCCACCGGGACAGGCGCCACGCTGACCCCGTCGGGCATTGTCGATATC
GGCTTCGACATCTTCTTCAAGGTGCTCGACAAGTCGTCGATATTGTCACCCGTTGACAGTGCGGTCGGCA
TCCTCATCAGCGCTGCCATCCTCATCATCCTGGCGTTGATCGGTGTGAACATGCTGGTGCTCCTGGTGAG
TGGCTGGATCCTGTCTTACGCCGGCGTGTTCTTCCTCGGCTTTGGTGGGTCCCGCTGGACCTCCGACATG
GCGATCGGCTACTACAAGACCGTTCTGAACATTGCCGCGCAGCTCTTTACCATGGTCCTGCTGGTTGGCA
TCGGCAAATCCTTCGTCGACCAGTACTACGCCGGGATGGATCCGGGCATCAGCCTGAAGGAACTGGGCGT
GATGTTGATCGTCGCCGTGGTGCTGTTTGCGCTCGTGACCAAACTGCCTTCGTTGATCGGCGGCCTGGCG
ATGGGTGGCAGCGTACACACCATGGGCAGTGGCCTCGGTACGGGCGCGGCGATGGCGGCGGTCGGCATGG
CCAGTGCGGCCGTGGGTGTCGCCGGCGCAGCCATTGCCACCGGGGCGGCGAGCATGGCTGGCGGTACTCA
AGCCTTGATGGCGGCGTGCTCGAAAGCGTCGCAGGACGTGGCCGGTGGTAGCGACATGCTTGCGAGCCTG
GCCGGCGGCAGTTCGTCGGGTGCGGGCCGATCGTCGGCCGGTAGCGGCGCAAGCCCGCTGGCGGCGGCGA
TGGACAGCAGTTCAGCCGGCGGCGGGCCGTCTGGTGGCAGCAGTTCACATTCCGGCAGATCCGACACCAG
GCAGGCGAGCGCCAAGCGGGGTGGAACGCCGGGCCAAGCGCAGTCGGGCGACATGGCTTCCGTAGTGGCC
AAGGTCGGGAAGGTCGTCGCAGGCACTGCGGCGAATCTGGCGCAAGGCAGCTGGGACGTCGCAAAGGCCA
GAGCCGGCGAAGTGAAGGATGCCGCGATGGATCGCATCGGCGAGACGACGGGCGGCAAGATCGCTGCGGC
CATCAAGGCGAGGAGCGACCAGCAACCCGCATTCGGCAGCGACAGCCTGGCAAAGGCAGACGACCAATCG
GTGGACGCAGAAGCGGAAATCGCCGCATTCCGTGACCGCGCCGCCCGATCTTCTTGA
 Primer design