SecReT4
Protein ID: 257091650
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4723
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]155141..155368 [-]
Producthypothetical protein
Component typeTrbK
UniProt IDC7RW36
KEGG IDapp:CAP2UW1_4723
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|257091650|ref|YP_003165293.1| hypothetical protein CAP2UW1_4723 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MITNRPALLTLAALVSSLISACSPETPKKEVPAVNDENCKWENMLKIEDKGTREQFASACARRGPGFTPS
PKKEW
 
Nucleotide Sequence: 228 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c155368-155141 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGATCACCAACCGCCCTGCCCTCCTGACGCTGGCAGCCCTTGTGTCCTCCTTGATCAGCGCCTGCTCAC
CAGAAACGCCCAAGAAGGAAGTGCCGGCCGTGAACGACGAAAACTGCAAGTGGGAAAACATGCTCAAGAT
CGAGGACAAGGGGACGCGCGAGCAATTCGCCTCGGCGTGTGCGCGTCGCGGTCCCGGGTTCACACCCAGT
CCAAAGAAAGAATGGTGA
 Primer design