SecReT4
Protein ID: 257091651
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4724
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]155384..156187 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDC7RW37
KEGG IDapp:CAP2UW1_4724
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 5.4e-07, Aligned region: 41..84
Protein Sequence: 267 a.a.     [Download]
>gi|257091651|ref|YP_003165294.1| hypothetical protein CAP2UW1_4724 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MKVLTSKPAATKLTATGTLLRALLLALFAGPAMTTPTHAAGIPVIDTANLSQTVISSIEAVAQTLKQIQQ
YQTQLQQYENMLQNTLAPAAYIWDSATSTMNQLRSAIDTLNYYKTNLGSIDAYLGKFQDASYYRGSPCFR
QGGCTDAEWAAIKENQRLGSEAQKRATDALFRGLDKQQAALEADAMTLQRLQASAQGATGQMQAISYANQ
LASQQANQLLQIRALLVAEQNAIATRNQVLADREAQQAAAGEQLRQGSYVASPVRNW
 
Nucleotide Sequence: 804 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c156187-155384 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGAAAGTCTTGACCAGCAAACCAGCCGCCACAAAGCTAACTGCCACAGGCACCCTGCTTCGGGCCCTGC
TTCTGGCCCTGTTCGCCGGCCCGGCAATGACGACGCCGACGCATGCAGCAGGGATCCCGGTTATCGACAC
CGCGAACCTCTCGCAGACCGTCATCAGCTCGATCGAAGCGGTCGCCCAGACGCTGAAGCAGATTCAGCAG
TACCAGACGCAACTGCAGCAGTACGAAAACATGCTGCAGAACACGCTGGCGCCGGCAGCCTATATCTGGG
ACTCGGCCACCAGCACGATGAACCAGCTGCGCAGTGCGATCGACACGCTGAATTACTACAAGACCAACCT
GGGGAGCATCGACGCGTACCTCGGCAAGTTCCAGGATGCGTCCTATTACCGCGGCTCGCCCTGCTTCAGG
CAAGGCGGTTGCACCGACGCGGAGTGGGCCGCGATCAAGGAGAACCAACGCCTCGGCTCCGAAGCACAGA
AGAGGGCCACCGATGCGCTGTTCCGTGGCCTCGACAAGCAACAAGCCGCCCTGGAAGCGGATGCCATGAC
CTTGCAGCGCCTGCAGGCGAGCGCGCAGGGTGCGACTGGCCAGATGCAGGCGATCAGCTACGCGAATCAG
CTCGCCAGCCAGCAGGCCAACCAACTGCTGCAAATCCGCGCCCTGCTGGTGGCCGAGCAGAACGCCATCG
CCACCCGCAACCAGGTGCTTGCGGATCGGGAAGCACAACAAGCCGCTGCCGGCGAGCAACTGCGTCAGGG
GAGCTACGTCGCCAGCCCGGTCCGTAACTGGTAA
 Primer design