SecReT4
Protein ID: 257091652
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4725
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]156206..157657 [-]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDC7RW38
KEGG IDapp:CAP2UW1_4725
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.1e-64, Aligned region: 289..474
Protein Sequence: 483 a.a.     [Download]
>gi|257091652|ref|YP_003165295.1| hypothetical protein CAP2UW1_4725 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MVDQVTEDQMSPEASPGELSRKSGVRRVNNLPVYLVGGVMTVFLAIMVLVAADRNAQQNKPNGGPKEKGG
NTRLFASEIAGEQKDGIIPPAAAKPLQVPELSPPATTDGAVLIARPDNLDTPPKPPTSAGGGTPQSSSRD
EELNRIRMAKMQQLEEAVKAKTTVQMVAPRSAGSAPGAAGYAGAPGSREETLARLAALRQQSEAAVHDDP
TAAYKARLATLQGAGIGGGGSGAASSSPQLLPSAAAGGRNNVAQFGNGSSGGSSGSSSGDQGDRWKLDSR
MEAPRSPFELRAGFVIPGTLISGINSQLPGQIMAQVAQNVYDTPTGKHLLIPQGSRLVGRYSSDVAYGQA
RVLVAWQRIVFPDGKAIDIGAMPGADGVGYAGLTDQVNNHYLRLFGSALLMSAVTAGITYSQGQNQGNSV
YGAPTASSAMSEALGQQLGQVTAQLIAKNMNIAPTLEIRPGYRFNVIVARDMTFSKPYQSFDY
 
Nucleotide Sequence: 1452 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c157657-156206 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGGTTGACCAAGTGACCGAAGACCAGATGTCCCCCGAGGCGTCGCCCGGCGAACTCTCGAGAAAATCCG
GCGTGCGCCGGGTCAATAACCTGCCGGTGTATCTCGTCGGCGGTGTCATGACCGTGTTCCTGGCCATCAT
GGTGCTGGTCGCTGCGGACCGTAATGCCCAGCAGAACAAGCCCAACGGCGGGCCGAAGGAGAAGGGTGGC
AATACCCGCCTGTTCGCCAGCGAGATCGCCGGCGAACAGAAGGATGGAATCATTCCACCGGCAGCCGCGA
AGCCGCTGCAAGTCCCCGAACTCTCCCCGCCCGCGACCACCGACGGCGCCGTGCTGATTGCACGCCCGGA
CAACCTCGATACCCCGCCAAAGCCACCGACCTCGGCCGGCGGTGGCACGCCCCAGAGCAGCTCCCGTGAC
GAAGAACTGAATCGCATCCGTATGGCGAAGATGCAGCAGCTCGAAGAAGCGGTGAAGGCCAAAACCACGG
TGCAGATGGTTGCCCCGCGCAGCGCCGGCTCGGCGCCCGGCGCTGCGGGCTATGCCGGCGCACCGGGTAG
CCGGGAGGAAACACTGGCGCGCCTGGCAGCCCTACGGCAACAGAGCGAGGCCGCGGTGCACGACGACCCG
ACGGCAGCCTACAAGGCCCGGCTGGCGACACTGCAGGGTGCCGGCATCGGGGGCGGCGGCAGCGGTGCCG
CCTCGTCGTCTCCCCAGTTGCTGCCCTCAGCGGCCGCGGGCGGCAGGAACAACGTCGCGCAATTCGGAAA
TGGCAGCAGCGGGGGCAGCAGCGGCAGCAGCAGCGGCGACCAGGGCGATCGCTGGAAGCTGGATTCCCGG
ATGGAAGCGCCGCGCTCGCCGTTTGAGCTGCGGGCTGGCTTCGTCATCCCGGGAACGCTGATCTCCGGGA
TCAACTCCCAACTACCGGGCCAGATCATGGCCCAGGTCGCGCAGAATGTGTACGACACGCCAACCGGCAA
ACATCTGTTGATCCCGCAAGGCTCGCGCCTGGTCGGCCGATACTCGAGTGATGTCGCCTACGGCCAGGCG
CGCGTGCTCGTCGCCTGGCAACGCATCGTCTTCCCCGATGGCAAGGCGATCGATATCGGCGCCATGCCGG
GCGCCGATGGTGTCGGCTATGCTGGCCTTACGGACCAGGTGAACAATCATTACCTGCGCCTGTTCGGATC
AGCCCTCCTGATGTCTGCCGTGACCGCCGGCATCACCTACAGCCAGGGCCAGAACCAGGGCAACAGTGTC
TATGGCGCACCGACCGCCAGCAGCGCGATGAGCGAAGCCCTGGGCCAGCAGCTCGGCCAAGTGACCGCGC
AGTTGATCGCCAAGAACATGAACATCGCACCGACGCTCGAGATCCGGCCGGGGTATCGCTTCAACGTCAT
TGTCGCCAGGGACATGACGTTCTCCAAGCCGTACCAATCGTTTGACTACTGA
 Primer design