SecReT4
Protein ID: 257091653
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4726
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]157664..158125 [-]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDC7RW39
KEGG IDapp:CAP2UW1_4726
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 7e-42, Aligned region: 35..153
Protein Sequence: 153 a.a.     [Download]
>gi|257091653|ref|YP_003165296.1| hypothetical protein CAP2UW1_4726 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MRQFALSALLVMALAGCASTAPYGNFATEPPAGLEERIATDTVKQLVTLYPPARTRFHLGQPTPDAYGSA
LVEALRAKGYALVEFKPGTAPQAGSPEAAAATAPGLNLHYLLDTAASPNLYRITVMVGQQSLSRAYLAQN
DRVAPAGAWVRKE
 
Nucleotide Sequence: 462 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c158125-157664 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGCGCCAGTTCGCCCTCTCCGCGCTCCTGGTGATGGCTCTGGCCGGTTGTGCGTCGACCGCGCCCTACG
GCAACTTCGCGACCGAGCCCCCAGCCGGCCTGGAGGAAAGGATTGCCACCGACACGGTCAAGCAGCTGGT
CACCCTGTACCCGCCGGCAAGAACGCGCTTCCATCTTGGCCAGCCGACGCCGGATGCCTATGGCAGCGCC
CTGGTGGAAGCACTGCGGGCGAAGGGCTATGCGCTCGTGGAGTTCAAGCCGGGAACGGCCCCGCAGGCAG
GCTCTCCGGAAGCCGCAGCGGCGACTGCGCCAGGGCTGAACCTGCACTACCTGCTCGACACAGCGGCCAG
TCCGAACCTTTACCGGATCACCGTGATGGTCGGGCAGCAATCGCTCAGCCGCGCCTACCTGGCACAGAAC
GACCGCGTGGCGCCGGCCGGTGCCTGGGTTCGCAAGGAGTGA
 Primer design