SecReT4
Protein ID: 257091654
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4728
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]159032..159805 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDC7RW40
KEGG IDapp:CAP2UW1_4728
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-58, Aligned region: 43..256
Protein Sequence: 257 a.a.     [Download]
>gi|257091654|ref|YP_003165297.1| hypothetical protein CAP2UW1_4728 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MNFADPLKRLIGRKPAADADRQSAKEPTTWGFRQDESENPYLAARRTWNEHVGGVVSSRQTWQVIGILSL
LIALAGVGGIIHIGSQSKFVPYVVQVDRLGQAVAVAPADRATPADARVIEASVASFIADARLVTPDVALQ
RKAVFRVYSMLAPNDPATARMNEWLNGAEDSSPFKRAAKETVSIEIASVLPQTPETWQVDWVETSRDRQG
ILKGQPFRMRALVTVYVAEPTPSTSEEQIRNNPIGLYVRDFSWAKQL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c159805-159032 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGAACTTCGCAGACCCACTCAAGCGCCTGATCGGCCGAAAGCCCGCAGCGGACGCCGATCGCCAAAGCG
CCAAAGAACCGACGACCTGGGGTTTCCGCCAGGACGAAAGCGAGAACCCCTACCTGGCCGCTCGTCGGAC
CTGGAACGAACATGTCGGCGGCGTCGTGTCGTCGCGCCAGACCTGGCAGGTGATCGGCATCCTGTCGCTG
TTGATCGCGCTGGCGGGTGTCGGCGGCATCATCCACATCGGCAGCCAATCGAAATTCGTGCCGTATGTCG
TCCAGGTCGACCGGCTCGGGCAGGCCGTGGCCGTGGCGCCGGCCGATCGCGCCACACCGGCCGATGCCCG
GGTGATCGAAGCGTCGGTGGCTTCCTTCATCGCCGACGCGCGCCTGGTAACACCCGACGTGGCCCTGCAG
CGCAAGGCGGTGTTCCGCGTGTACTCGATGCTCGCACCGAACGACCCGGCCACGGCCAGGATGAACGAAT
GGCTGAACGGCGCCGAAGACTCCAGCCCGTTCAAGCGGGCCGCCAAGGAGACGGTCAGCATCGAGATCGC
CTCGGTGCTGCCGCAAACGCCGGAAACCTGGCAGGTCGACTGGGTCGAGACCAGCCGCGACCGCCAGGGG
ATCCTGAAGGGCCAGCCCTTCCGCATGCGTGCCCTGGTGACGGTCTATGTCGCCGAACCGACCCCCAGCA
CCAGCGAAGAACAGATTCGCAACAATCCGATCGGCCTGTACGTCCGTGACTTCTCCTGGGCGAAGCAGCT
CTAA
 Primer design