SecReT4
Protein ID: 257091655
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4729
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]159802..162360 [-]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDC7RW41
KEGG IDapp:CAP2UW1_4729
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 6.8e-50, Aligned region: 223..431
AAA_10 [PF12846], Evalue: 5e-31, Aligned region: 489..772
Protein Sequence: 852 a.a.     [Download]
>gi|257091655|ref|YP_003165298.1| hypothetical protein CAP2UW1_4729 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MIAGIAFAIATLGALLLLVLYARIRAVDEELKLKKHRSRDAGLADLLNYAAMVDDGVMVGKNGAFLAAWL
YKGADNASSTDEQREIVSLRINQALSGLGNGWMVHVDAARLPAPNYLDRGTSHFPDGVSAAIDEERRQLF
EGLGTLYEGYYVLTLTWFPALLAQRKFVELMFDDDAKAPDHKAHTHGLIEFFKRECVSIESRLSSAVELQ
RLRGHQVVNEDGSAVTHDDFLRWLQFCVTGVNHPVQLPSNPMYLDALIGGQELWTGVVPKVGRKFIQVVA
IEGFPLESTPGMLTALGELACEYRWSSRFIFMDTHEAVRHLDKFRKKWRQKIRGFFDQVFNTHLGPIDQD
ALSMVADAEAAIAEVNSGLVAQGYYTSVVVLMDEDRSRLEASARQVEKAVNRLGFAARIETLNTMDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSTIWTGSNAAPCPMYPPLAPALMHCVTHGATPFRLNLHVRDLGH
TFLFGPTGSGKSTHLGILAAQLRRYAGMSIFAFDKGMAMYPLAAAIRAQTQGRSGRHFTVAADDDQLAFC
PLQFLETKGDRAWAMEWIDTLLALNDLHTTPAQRNEIGHAILSLHASGGRTLSEFSVTIQDEAIRDAIRQ
YTVDGAMGHLLDAEEDGLSFSDFTVFEIDELMNLGEKYALPVLLYLFRRIERALHGQPAVIMLDEAWLML
GHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNLYARDEDTAALYRRMG
LNTRQIEILATAIPKRQYYYVSENGRRLYDLALGPLALAFVGASDKESLATIQHLESKLGDGWVHEWLAG
RGLTLDTYGVAA
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c162360-159802 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGATCGCCGGAATTGCCTTCGCCATTGCCACCCTCGGCGCCTTGCTGCTGCTCGTGCTTTACGCCCGCA
TCCGTGCGGTCGACGAGGAACTGAAGCTCAAAAAGCATCGCTCGCGGGATGCCGGGCTGGCCGACCTGCT
CAACTACGCCGCGATGGTCGACGACGGCGTGATGGTGGGCAAAAACGGCGCCTTCCTGGCTGCCTGGCTG
TACAAGGGCGCCGACAACGCCAGCAGCACCGACGAGCAACGCGAGATCGTCTCGTTGCGCATCAACCAGG
CGCTCTCCGGTCTCGGCAATGGCTGGATGGTGCACGTGGACGCAGCGCGGCTGCCAGCACCCAACTATCT
CGATCGTGGCACCTCCCACTTTCCCGACGGGGTGTCGGCAGCGATCGACGAGGAGCGGCGGCAACTGTTC
GAGGGTCTGGGCACCCTCTACGAAGGCTACTATGTGCTGACGCTGACCTGGTTCCCGGCGCTGCTCGCGC
AGCGCAAGTTCGTCGAGCTGATGTTCGACGATGACGCCAAGGCACCCGACCACAAGGCGCACACCCACGG
CTTGATCGAGTTCTTCAAGCGCGAGTGCGTCAGCATCGAGTCGCGGCTGTCGTCGGCGGTGGAGCTGCAG
CGGCTACGCGGCCACCAGGTGGTCAACGAGGACGGTTCGGCAGTCACCCACGATGACTTCCTGCGCTGGC
TGCAGTTCTGCGTCACCGGCGTGAATCATCCGGTGCAGTTGCCGAGCAACCCGATGTACCTGGACGCGCT
CATCGGTGGGCAGGAACTGTGGACCGGCGTCGTGCCGAAGGTCGGCCGCAAGTTCATCCAGGTCGTCGCC
ATCGAAGGCTTCCCGCTGGAATCGACGCCGGGCATGTTGACCGCCCTCGGTGAGCTGGCCTGCGAATATC
GCTGGTCGTCGCGTTTCATCTTCATGGATACGCACGAGGCGGTAAGACACCTCGACAAGTTCCGCAAGAA
ATGGCGGCAGAAGATTCGCGGCTTCTTCGACCAGGTCTTCAACACCCACCTCGGGCCGATCGATCAGGAC
GCGCTGTCGATGGTCGCCGATGCCGAAGCGGCGATTGCCGAAGTCAATAGCGGCCTAGTCGCGCAAGGCT
ACTACACCAGCGTTGTCGTGCTCATGGACGAGGATCGCAGCCGCCTGGAAGCGTCTGCCCGCCAGGTGGA
AAAGGCCGTCAACCGCCTCGGCTTCGCCGCCCGCATCGAGACCCTCAACACCATGGACGCCTACCTCGGC
AGCCTGCCCGGCCACGGCGTGGAAAACGTCCGCCGGCCGCTGATCAACACCATGAACCTGGCCGATCTGC
TGCCGACGAGCACCATCTGGACCGGCAGCAACGCTGCCCCCTGCCCGATGTACCCGCCACTCGCGCCGGC
GCTGATGCACTGCGTCACCCACGGCGCGACACCGTTCCGCCTGAACCTGCACGTGCGCGACCTTGGCCAT
ACCTTCCTGTTCGGCCCGACCGGCTCCGGCAAGTCGACCCACCTCGGCATCCTCGCTGCGCAGCTTCGCC
GCTACGCCGGCATGTCGATCTTTGCCTTCGACAAGGGCATGGCGATGTATCCGCTCGCTGCCGCCATCCG
CGCCCAGACCCAGGGTCGCAGCGGCCGGCACTTCACGGTGGCGGCCGACGACGATCAGTTGGCCTTCTGC
CCGCTGCAGTTCCTCGAAACCAAGGGCGACCGCGCCTGGGCGATGGAGTGGATCGACACCCTCCTCGCCT
TGAACGACCTGCACACCACGCCGGCGCAGCGCAACGAGATCGGCCATGCGATCCTCAGTCTGCACGCCAG
CGGCGGCCGCACCCTGTCGGAATTCTCGGTCACCATCCAGGACGAAGCGATCCGCGACGCGATCCGTCAA
TACACCGTTGATGGTGCCATGGGGCACCTGCTGGACGCCGAAGAAGACGGCTTGTCGTTCTCCGATTTCA
CCGTCTTCGAAATCGACGAATTGATGAACCTCGGCGAGAAGTACGCGCTGCCGGTACTGCTCTATCTCTT
CCGACGCATCGAGCGCGCCCTGCACGGCCAGCCGGCCGTGATCATGCTCGACGAGGCGTGGTTGATGCTC
GGGCACCCGGCCTTTCGCGCCAAGATCCGCGAGTGGCTCAAGGTCTTGCGCAAGGCCAACTGCCTGGTGC
TGATGGCCACGCAAAGTCTTTCCGACGCCGCCAATTCAGGCATTCTGGATGTGATCGTCGAATCGACCGC
GACCAAGATCTTCCTGCCCAACCTCTATGCCCGCGACGAGGACACGGCCGCCCTCTACCGCCGCATGGGC
CTCAACACCCGGCAGATCGAGATTCTGGCGACAGCCATTCCCAAGCGCCAGTACTACTACGTCTCGGAGA
ACGGCCGCCGCCTGTACGACCTCGCCCTCGGCCCCCTGGCGCTCGCCTTCGTCGGCGCCTCCGACAAGGA
GTCGCTGGCCACCATCCAGCACCTGGAGAGCAAGCTGGGCGATGGCTGGGTGCACGAGTGGCTGGCCGGG
CGGGGATTGACGCTGGACACCTATGGAGTCGCCGCATGA
 Primer design