SecReT4
Protein ID: 257091656
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4730
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]162357..162668 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDC7RW42
KEGG IDapp:CAP2UW1_4730
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.9e-26, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|257091656|ref|YP_003165299.1| hypothetical protein CAP2UW1_4730 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MALRKIPIRRAGNRDNLFMGGDRELVMFSGLLAFALVFSAQELRATVVGLLLWFGALYALRIMAKADPRM
RHVYLRHRRYKPYYPARSTPFRDNTTSQGKQYQ
 
Nucleotide Sequence: 312 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c162668-162357 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGGCGCTGCGCAAGATCCCCATTCGGCGGGCCGGTAATCGGGACAACCTGTTCATGGGCGGCGATCGTG
AACTGGTCATGTTCTCGGGTCTGCTGGCTTTCGCGCTGGTCTTCAGCGCACAGGAGCTGCGGGCCACGGT
CGTCGGGCTGCTGCTCTGGTTCGGCGCGCTCTACGCGCTGCGGATCATGGCCAAGGCAGACCCCCGGATG
CGCCACGTGTACCTGCGGCACCGGCGCTACAAGCCGTACTACCCGGCGCGCAGCACGCCCTTCCGGGACA
ACACGACCAGCCAGGGGAAGCAGTACCAATGA
 Primer design