SecReT4
Protein ID: 257091657
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4731
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]162671..163093 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDC7RW43
KEGG IDapp:CAP2UW1_4731
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.9e-18, Aligned region: 20..110
Protein Sequence: 140 a.a.     [Download]
>gi|257091657|ref|YP_003165300.1| hypothetical protein CAP2UW1_4731 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MHSPALPYPLARSTLFYCGLAILLLVFLLVPQHALAAEGTGGSLPYESWLTNLRNSVTGPVAFALAMIGI
VVAGGVLIFGGDLNGFFRTLIFVVLVMALLVGAQNMMSSFFGRGAEIAALGAGGFDPVQLAGGIAPGRLA
 
Nucleotide Sequence: 423 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c163093-162671 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGCACTCGCCCGCCCTCCCCTACCCGCTCGCCCGTTCGACTCTGTTCTATTGCGGACTGGCGATCCTCC
TGCTGGTGTTCTTGCTGGTCCCGCAACACGCCCTGGCAGCGGAAGGCACCGGCGGGTCGCTGCCCTATGA
AAGCTGGCTGACCAACCTCCGCAACTCGGTCACCGGCCCGGTGGCGTTCGCACTGGCGATGATCGGCATC
GTCGTTGCGGGTGGCGTGCTGATCTTCGGTGGCGATCTGAACGGCTTCTTCCGCACCTTGATCTTCGTCG
TTCTCGTCATGGCCCTGCTGGTTGGCGCGCAAAACATGATGAGCAGCTTCTTCGGCCGTGGCGCAGAAAT
CGCCGCCCTCGGTGCAGGCGGGTTCGACCCGGTCCAGCTTGCCGGCGGGATCGCTCCGGGAAGGCTCGCC
TGA
 Primer design