SecReT4
Protein ID: 257091658
T4SS name [ID]Trb [234]
Gene symbol-
Locus tagCAP2UW1_4732
StrainCandidatus Accumulibacter phosphatis clade IIA str. UW-1
Repliconplasmid pAph01 [GenBank: NC_013193] [Browse all T4SS(s) in this replicon]
Location [Strand]163107..164069 [-]
Productconjugal transfer ATPase TrbB
Component typeTrbB
UniProt IDC7RW44
KEGG IDapp:CAP2UW1_4732
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-84, Aligned region: 28..295
FtsK_SpoIIIE [PF01580], Evalue: 4.1e-08, Aligned region: 139..192
AAA_10 [PF12846], Evalue: 1.7e-06, Aligned region: 150..192
AAA_29 [PF13555], Evalue: 8.8e-06, Aligned region: 146..174
AAA_19 [PF13245], Evalue: 1.2e-05, Aligned region: 144..189
AAA_16 [PF13191], Evalue: 4.6e-05, Aligned region: 138..174
DUF87 [PF01935], Evalue: 6e-05, Aligned region: 149..190
Protein Sequence: 320 a.a.     [Download]
>gi|257091658|ref|YP_003165301.1| hypothetical protein CAP2UW1_4732 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
MAEIEESVSSLKERAKRKLERDLGSLLMDALADPRTVEMMLNADGRLWQERLGEKMHCIGSISFARAEAI
IKTVAGYHSKEVTRHKPILEGELPIDGSRFAGQLPPVVPAPTFAIRKKAVAIFTLDQYVEAGIMTAAQQA
TLTAAIKAHRNILVIGGTGSGKTTLVNAIINAMVEFDPAERVFIIEDTGEIQCAAENFVQYHTSLEVTMT
MLLKTTLRMRPDRILVGEVRGPEALDLLMAWNTGHEGGAATLHANNARSGLDRLAMLISMHPESPRPIEP
LIGEAVHVIVHIARTPEGRCVQEILEVAGYANGAYLTRPL
 
Nucleotide Sequence: 963 bp     [Download]
>gi|257091505|ref|NC_013193.1|:c164069-163107 Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph01, complete sequence
ATGGCAGAAATCGAAGAGTCCGTTTCCTCCCTCAAGGAACGGGCGAAGAGGAAGCTGGAGCGTGATCTGG
GGTCGCTCCTGATGGACGCCCTGGCCGACCCCAGGACCGTCGAGATGATGCTCAATGCCGACGGCAGGCT
GTGGCAGGAGCGGCTGGGCGAGAAGATGCACTGCATTGGCAGCATTTCCTTCGCGCGCGCCGAAGCGATC
ATCAAGACCGTTGCCGGCTATCACAGCAAGGAAGTGACGCGGCACAAGCCGATTCTCGAAGGCGAACTGC
CGATTGATGGCTCGCGCTTCGCCGGCCAGCTTCCGCCGGTCGTTCCCGCGCCAACTTTCGCCATCCGCAA
GAAGGCCGTGGCGATATTCACGCTCGACCAGTACGTCGAGGCTGGGATCATGACCGCTGCGCAGCAGGCG
ACCCTGACGGCCGCCATCAAGGCGCACCGGAACATCCTGGTGATCGGTGGCACCGGTTCCGGCAAGACCA
CGCTGGTCAACGCGATCATCAACGCCATGGTCGAGTTCGATCCCGCCGAGCGCGTTTTCATCATCGAGGA
CACCGGCGAGATCCAGTGTGCCGCCGAGAACTTCGTGCAGTACCACACCTCGCTCGAAGTCACGATGACC
ATGCTTCTCAAGACCACCCTGCGCATGCGGCCCGACCGGATACTGGTCGGCGAAGTACGCGGCCCCGAAG
CGCTGGACCTGCTGATGGCCTGGAACACTGGCCACGAAGGCGGTGCGGCCACGCTCCACGCCAACAATGC
CCGGTCCGGGCTTGACCGCCTCGCCATGCTGATCAGCATGCACCCGGAATCACCGCGGCCGATCGAACCG
CTGATCGGCGAAGCGGTGCACGTCATCGTCCATATCGCTCGCACCCCCGAAGGCCGCTGCGTTCAGGAGA
TCCTGGAAGTGGCCGGCTACGCCAACGGCGCTTACCTCACTCGTCCTCTGTAA
 Primer design