SecReT4
Protein ID: 257125741
T4SS name [ID]Trb [789]
Gene symbol-
Locus tagLebu_0962
StrainLeptotrichia buccalis C-1013-b
Repliconchromosome [GenBank: NC_013192] [Browse all T4SS(s) in this replicon]
Location [Strand]1051962..1053422 [-]
Producthypothetical protein
Component typeTrbL
UniProt IDC7N9N3
KEGG IDlba:Lebu_0962
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.5e-12, Aligned region: 43..253
Protein Sequence: 486 a.a.     [Download]
>gi|257125741|ref|YP_003163855.1| hypothetical protein Lebu_0962 [Leptotrichia buccalis C-1013-b]
MAAANFQFDTALIEPIISMLDTGMTTLMVVILTLASTFAVLDLSFTAFFNWSENIGNTLVETLKKLLRYV
LTFELIKMYKKLLDMAYKLFSDIGNLFGEGLGSPLKVQSIWDKLWEELSKFLSIGLKFQDFWAILYFILF
IIGFIFLVFIISTITIAIIQFHVVGRLAIIYLACLPLDTLSDIGRKTLGAVVGSGTHLMVAVALSSMGIK
ILKSYPIPENIGAENNEPHTIIVWLAVFIAISFLIKNYQSIASLILYGHGGLNGSQLGYFTGNVISAGGS
AIGGITSVLGGAAVGGLGAAIGTVAGGISSGGAGALAGMKTGAKIGYEVGKYPGKMTASAAENAGKAIKI
MTMDFDPVTSAKKVKNTATDGIKKIMGNKKDDRENPERNESQETENTNTENENSQDTNEKNQEKMKNDNS
NEASNEDSRKQSSDNGTQKNSENTRSEKTKENSSNKTFAESEMERERKNDETFTESEINREKENKE
 
Nucleotide Sequence: 1461 bp     [Download]
>gi|257124814|ref|NC_013192.1|:c1053422-1051962 Leptotrichia buccalis C-1013-b chromosome, complete genome
TTGGCAGCGGCAAATTTTCAATTTGATACGGCACTAATTGAACCAATAATCAGTATGCTGGATACTGGGA
TGACAACTTTAATGGTTGTAATATTGACACTTGCTTCTACATTTGCTGTACTGGACTTATCATTTACAGC
TTTTTTTAACTGGTCGGAAAATATAGGGAATACTCTTGTCGAAACATTAAAAAAACTTTTAAGATATGTA
CTAACTTTTGAACTTATAAAAATGTACAAGAAACTATTAGATATGGCGTATAAATTATTTTCCGATATAG
GAAATTTATTTGGAGAAGGACTGGGAAGTCCATTAAAAGTACAGAGTATTTGGGATAAGTTATGGGAAGA
ATTAAGTAAGTTTTTAAGTATAGGTTTAAAGTTCCAAGATTTTTGGGCTATTCTGTATTTTATTCTCTTT
ATTATTGGATTCATATTTCTAGTGTTTATAATATCAACAATAACAATAGCTATAATACAGTTCCATGTAG
TCGGAAGACTGGCAATAATATATCTTGCTTGTCTTCCACTTGATACTTTGAGCGATATAGGTAGAAAAAC
TTTAGGAGCAGTAGTTGGATCAGGAACTCATCTAATGGTTGCAGTCGCTCTATCATCTATGGGAATAAAA
ATACTAAAATCCTATCCTATTCCTGAAAATATAGGAGCAGAAAATAACGAGCCTCATACTATAATTGTGT
GGCTTGCAGTGTTTATAGCAATTTCATTTTTAATAAAAAATTATCAGAGCATAGCTTCTCTAATTTTATA
TGGACACGGTGGATTAAATGGTTCACAGCTTGGATACTTCACGGGGAATGTTATCAGTGCAGGTGGGTCA
GCTATAGGTGGAATTACATCCGTCTTGGGAGGTGCGGCAGTCGGTGGACTAGGTGCTGCAATTGGTACAG
TTGCTGGAGGAATATCTTCTGGAGGAGCAGGAGCATTAGCAGGTATGAAAACTGGTGCAAAAATAGGATA
TGAAGTTGGAAAATATCCTGGAAAGATGACTGCTTCGGCTGCTGAAAATGCAGGAAAAGCAATAAAAATA
ATGACAATGGACTTTGATCCAGTTACCTCAGCTAAAAAGGTAAAAAACACAGCTACAGATGGAATAAAAA
AAATTATGGGAAATAAAAAAGATGATAGAGAAAATCCTGAAAGAAATGAATCTCAGGAAACAGAAAATAC
AAATACTGAAAATGAAAATTCTCAAGATACAAATGAAAAAAATCAAGAAAAGATGAAAAACGATAACAGT
AATGAAGCTTCAAATGAAGATTCTCGAAAACAGTCAAGTGATAACGGAACACAAAAAAATTCAGAAAATA
CAAGATCTGAAAAGACGAAAGAAAATAGCAGCAATAAAACCTTTGCAGAATCTGAAATGGAAAGAGAAAG
AAAAAACGATGAAACTTTTACAGAATCTGAAATAAATAGGGAAAAAGAGAATAAAGAATAA
 Primer design