SecReT4
Protein ID: 257125751
T4SS name [ID]Trb [789]
Gene symbol-
Locus tagLebu_0972
StrainLeptotrichia buccalis C-1013-b
Repliconchromosome [GenBank: NC_013192] [Browse all T4SS(s) in this replicon]
Location [Strand]1062260..1063084 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDC7N9P3
KEGG IDlba:Lebu_0972
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.9e-47, Aligned region: 66..272
Protein Sequence: 274 a.a.     [Download]
>gi|257125751|ref|YP_003163865.1| conjugal transfer protein TrbG [Leptotrichia buccalis C-1013-b]
MTGNKLKKINKRILSILFLTLISANIFANDGNAKNDITVDTVKNNQRLFDDDGILSGKKEAIKKTSVVFN
YSENSIYEVYSKPDYLTTLRLAPNEKVIFKAGGDTERWMIEEAVGGKENRTYIYIKPLEEDIKTNINIVT
DKHSYFINIESKNGEYNPLVEWQYPNERKILMNEYEDNSEAIGTTDLMKLNYRYFWNKNSKLSPVQVFDN
GKKTFIVLKANLQEMPAFYVKGLDNQLSLVNTKIEGRNVMINSVVKEIHMTLGKKTLKIYNRKK
 
Nucleotide Sequence: 825 bp     [Download]
>gi|257124814|ref|NC_013192.1|:c1063084-1062260 Leptotrichia buccalis C-1013-b chromosome, complete genome
ATGACAGGGAACAAGTTAAAGAAAATTAATAAAAGAATACTCTCAATATTGTTTTTGACATTGATATCAG
CGAATATTTTTGCAAATGATGGAAATGCAAAAAATGATATTACAGTAGATACAGTAAAAAATAATCAAAG
GCTGTTTGATGATGATGGAATATTAAGTGGGAAGAAAGAGGCGATAAAAAAGACATCTGTTGTATTCAAT
TATTCTGAAAACAGTATATATGAAGTTTATTCTAAACCAGACTATTTAACAACTTTAAGGCTAGCTCCAA
ATGAAAAAGTAATATTTAAGGCTGGTGGAGATACAGAACGCTGGATGATTGAAGAAGCTGTAGGTGGAAA
AGAAAATAGAACATACATATACATAAAACCACTTGAAGAAGATATCAAGACTAATATAAATATAGTAACG
GATAAACACAGTTATTTTATTAATATTGAATCTAAAAATGGAGAATACAATCCTTTAGTGGAATGGCAAT
ATCCAAATGAAAGAAAAATATTGATGAATGAGTATGAAGATAATTCAGAAGCTATTGGTACAACGGACTT
GATGAAGCTTAATTATAGATATTTTTGGAACAAAAATTCTAAACTTTCACCAGTTCAGGTATTTGATAAT
GGAAAAAAAACGTTTATAGTGTTGAAGGCAAATTTACAAGAAATGCCAGCTTTTTATGTTAAAGGGTTAG
ATAATCAACTGTCTTTAGTTAACACGAAAATTGAGGGGCGTAACGTTATGATTAATAGTGTTGTAAAGGA
AATACACATGACACTTGGGAAAAAAACATTAAAAATATATAACCGAAAAAAATAA
 Primer design