SecReT4
Protein ID: 259909645
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30200
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3316315..3317844 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDD0FVV5
KEGG IDepy:EpC_30200
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.4e-100, Aligned region: 8..484
Protein Sequence: 509 a.a.     [Download]
>gi|259909645|ref|YP_002650001.1| hypothetical protein EpC_30200 [Erwinia pyrifoliae Ep1/96]
MTANSYLEYFLVLFGWVMNNAMWSILGSTGLFALPLVFKVLGVWLKVREEGADEGNKGLLALPRIEHAIY
VSFLVMLFCCIPLLPVDISTIKFDSSRAKQCGVSVPTPQNSGYKGLINDFDGRTAEVPVWWYLLHSMSKG
TTQAMIASIPCGTQLRQMRFDVQNTRLRDPVLLQEVQEFADQCYSRAYFRLKNSNSQLSDATINAVGWIG
SSYFLNTAGYYDDYTAMKPRSQWPYDSSRDSGYPDTGQGGYPTCKTWWSDSTSGLSKRVLANFSDGTRRE
MQRQFPGAQWEELTMRWLVSPRNAGLSGAGTTYAVGGNDTTSGLAGNITRLTSTIGLGLKQAEALPGFDA
LKQALPMIQALLQMMIITVIPVLMMFSAYEPKTIVTISFALFALQFITFWWELAGWLDDRLITILYDNMA
EQGISNSSVPFAGFFSSTADGWIMNLVLGMMYVVFPAFWMGMLSWAGVKIGGVMDSAMVSASKMPQQAGI
EGGKAAKSAAKSAITKGTG
 
Nucleotide Sequence: 1530 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3317844-3316315 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGACCGCGAACAGTTATCTGGAGTATTTTCTCGTCCTGTTTGGCTGGGTGATGAACAATGCCATGTGGA
GCATCCTCGGCAGCACCGGGCTGTTTGCCCTGCCGCTGGTGTTTAAGGTGCTGGGCGTCTGGCTGAAGGT
CAGAGAAGAGGGGGCCGACGAAGGCAACAAGGGGTTGCTGGCACTGCCGCGCATCGAGCACGCTATTTAC
GTTTCGTTTCTGGTGATGCTGTTCTGCTGCATTCCGCTGCTGCCGGTCGATATCAGCACCATTAAGTTCG
ACAGCTCGCGCGCGAAGCAGTGCGGCGTCAGTGTCCCGACCCCGCAAAACTCCGGCTATAAGGGGCTTAT
CAATGACTTTGACGGGCGCACCGCCGAAGTGCCGGTGTGGTGGTACCTGCTGCATTCCATGTCGAAAGGC
ACCACTCAGGCGATGATAGCCTCCATTCCCTGCGGCACCCAGCTGCGTCAGATGCGTTTCGACGTGCAGA
ACACCAGACTGCGCGACCCGGTGCTGTTGCAGGAGGTGCAGGAGTTTGCCGATCAGTGCTATTCACGGGC
TTATTTCAGGCTGAAGAACAGCAACAGCCAGCTGAGCGATGCCACCATCAACGCGGTGGGCTGGATTGGC
AGCAGCTACTTCCTGAACACCGCCGGGTATTACGACGACTATACGGCGATGAAGCCGCGCAGCCAGTGGC
CGTACGACAGCAGTCGCGACAGCGGTTACCCGGATACGGGCCAGGGCGGCTATCCCACCTGTAAAACCTG
GTGGTCAGATAGCACATCCGGACTGAGCAAGCGCGTGCTGGCCAACTTCAGCGACGGTACGCGCAGAGAG
ATGCAGCGTCAGTTTCCGGGGGCGCAGTGGGAGGAGCTGACCATGCGCTGGCTGGTCAGCCCGCGTAACG
CGGGGTTGTCCGGAGCGGGAACCACTTATGCGGTCGGTGGTAACGATACGACCTCGGGCCTGGCCGGAAA
TATCACGCGCCTGACGTCTACCATCGGGCTCGGCCTGAAACAGGCTGAAGCGCTGCCGGGGTTTGATGCG
CTGAAGCAGGCTCTGCCGATGATACAGGCGCTGTTGCAGATGATGATCATCACGGTGATACCGGTACTGA
TGATGTTCAGCGCCTATGAGCCCAAAACGATTGTGACCATCTCGTTTGCACTGTTTGCGCTGCAGTTCAT
CACCTTCTGGTGGGAACTGGCGGGCTGGCTCGACGACCGTCTAATCACCATTCTTTACGACAATATGGCA
GAGCAGGGGATCTCCAACAGCAGCGTGCCGTTTGCAGGGTTCTTCAGCTCCACGGCCGATGGCTGGATTA
TGAATCTGGTGCTGGGAATGATGTATGTGGTGTTTCCTGCGTTCTGGATGGGGATGCTGAGTTGGGCTGG
GGTAAAAATAGGGGGAGTTATGGATTCAGCGATGGTTTCTGCTTCTAAAATGCCACAACAGGCAGGTATT
GAAGGTGGGAAAGCAGCCAAAAGCGCAGCAAAATCTGCGATAACAAAAGGGACAGGTTGA
 Primer design