SecReT4
Protein ID: 259909647
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30220
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3318195..3319598 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDD0FVV7
KEGG IDepy:EpC_30220
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 467 a.a.     [Download]
>gi|259909647|ref|YP_002650003.1| hypothetical protein EpC_30220 [Erwinia pyrifoliae Ep1/96]
MNRYLLMTGIWLAASSLPAAAVDASLSSSGGSVSGAVSDGLFYSIGGGSVTSPPPSRSNMSRLGLNGGWS
SDLMCGNFDLKTTVGNQLNGITSGFKDLMGNVIQGATGAVMSMPAMAIQRANPGLYEMLTNGVLQAGINF
DKGQLNCQNMSKKLADYTMGSKWQQAAVSEEYKDIVAGSGGDAVSSDQKLQKATGEEGVTWVGGEKRGGK
GQRAIQPTRDLAKAGYNMMNGLPVTSNNSVAAASCNGSACQRYKTSDEASAAVVKVLGDRSIRTCRETSE
CASGGSENQPGSTIAGSGFSPLLEDATKENLEQLGKLVNGQLPPTADNLAGIRTGSLVVTRGVIQALRDD
QDKAALVQRLAGELAMADTVETALTMRRMLTTGQSEPNAAGQTEAIAEGDRRIDALDREIAALRNEMELR
KSISSNSLLTTLERQGARNQDNRLQQTSGSEDQGFGRMGQTQPTGAN
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3319598-3318195 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAACAGATATCTTCTGATGACCGGCATTTGGCTGGCAGCATCCTCGCTGCCGGCAGCGGCCGTTGACG
CGTCACTCTCTTCTTCAGGCGGATCGGTAAGCGGGGCGGTCAGTGATGGCCTGTTTTATTCCATCGGCGG
TGGATCGGTGACCTCTCCGCCGCCCAGCCGCAGCAATATGTCCCGTCTGGGGCTCAACGGCGGCTGGAGC
AGCGACCTGATGTGCGGCAACTTCGACCTGAAAACCACCGTGGGTAACCAGCTCAACGGTATTACCAGCG
GCTTCAAGGATCTGATGGGCAACGTTATCCAGGGCGCGACGGGGGCGGTGATGAGCATGCCGGCGATGGC
CATCCAGCGGGCGAATCCGGGGCTGTATGAAATGCTGACTAACGGCGTATTGCAGGCGGGTATTAACTTC
GACAAGGGGCAGCTCAACTGCCAGAACATGTCGAAGAAGCTGGCCGACTATACAATGGGCAGCAAATGGC
AGCAGGCTGCGGTGTCGGAGGAGTATAAGGATATCGTCGCTGGCAGCGGCGGTGATGCCGTCTCCAGCGA
CCAGAAATTGCAGAAAGCTACCGGCGAGGAGGGCGTCACCTGGGTAGGGGGCGAGAAGCGCGGAGGCAAG
GGGCAGCGCGCCATCCAGCCAACCCGTGACCTCGCTAAAGCGGGCTACAACATGATGAACGGCCTGCCGG
TCACCAGCAACAACAGCGTTGCTGCTGCCAGCTGCAACGGCAGCGCCTGCCAGCGTTACAAAACCTCTGA
CGAGGCGTCGGCGGCGGTGGTGAAAGTGCTGGGCGACCGCTCCATCCGTACCTGCCGGGAAACCAGCGAG
TGTGCCAGCGGCGGGAGCGAAAACCAGCCGGGCAGCACCATTGCCGGTAGCGGTTTCTCACCGCTGCTGG
AAGATGCCACCAAAGAGAACCTTGAGCAGCTGGGTAAGCTGGTTAACGGCCAGCTGCCGCCGACCGCCGA
TAACCTGGCCGGGATCAGAACCGGCAGTCTGGTGGTCACGCGCGGGGTGATACAGGCACTGCGCGACGAT
CAGGATAAGGCCGCGCTGGTTCAGCGTCTTGCCGGTGAACTTGCTATGGCCGACACCGTGGAGACCGCGC
TGACCATGCGCCGTATGCTCACCACCGGTCAATCAGAACCTAACGCCGCCGGGCAGACGGAAGCCATTGC
CGAAGGTGACCGCCGCATTGATGCGCTCGATCGCGAAATCGCCGCCCTGCGTAACGAGATGGAGCTGCGT
AAATCCATCAGCAGTAACAGCCTGCTGACCACGCTGGAGCGTCAGGGGGCGCGCAATCAGGACAACCGCC
TGCAGCAGACGTCCGGCAGTGAGGATCAGGGGTTCGGCAGGATGGGGCAGACGCAGCCGACGGGAGCGAA
CTGA
 Primer design