SecReT4
Protein ID: 259909648
T4SS name [ID]Tfc [756]
Gene symbol-
Locus tagEpC_30230
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T4SS(s) in this replicon]
Location [Strand]3319610..3320581 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDD0FVV8
KEGG IDepy:EpC_30230
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.5e-91, Aligned region: 33..311
Protein Sequence: 323 a.a.     [Download]
>gi|259909648|ref|YP_002650004.1| hypothetical protein EpC_30230 [Erwinia pyrifoliae Ep1/96]
MNITFSRPRRLALATIMACSGTLASVNTAGLLASAASPDCISWRVSGICYWLMCTPLGCTVKTSVKVTHF
IPQAVVSAWLSPGDNPWTEMSALSATADGAESVLLGGAAGVATGGGRQEMKVPGMRSQNLHFYYAGAYGH
PATKIIGGMVPGYSCDSAATPFIPYFVSALDALAWRTGVPESVYPEALIPGQREVGSTPSGNMWGNVYPR
SGFVTQTDGYKSAAVVVQRVADIITRQGQLHVYNPLVGQRSAGYWPPGAVSENSGSKNHKWQRLSPRLSQ
SCAVFPDVGGQIAQNGNYAWALWQPYSCCKRRGQTFLYSTDFS
 
Nucleotide Sequence: 972 bp     [Download]
>gi|259906682|ref|NC_012214.1|:c3320581-3319610 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAACATCACTTTCTCCCGCCCGCGCCGGCTGGCGCTGGCCACGATCATGGCCTGTAGCGGCACCCTGG
CCAGCGTCAATACGGCAGGCCTGCTCGCCAGCGCCGCCAGTCCGGACTGCATCAGCTGGCGCGTCAGCGG
TATCTGTTACTGGCTGATGTGTACGCCCTTAGGCTGCACGGTCAAAACCTCCGTCAAGGTGACGCACTTT
ATCCCGCAGGCCGTTGTCTCCGCCTGGCTCAGTCCGGGCGACAATCCCTGGACGGAGATGTCTGCGCTCA
GCGCCACGGCAGACGGCGCAGAAAGCGTCCTGTTGGGCGGCGCGGCAGGCGTGGCAACCGGTGGTGGTCG
TCAGGAGATGAAAGTCCCCGGCATGCGCAGTCAGAACCTGCATTTCTATTACGCCGGTGCGTATGGCCAT
CCTGCGACAAAGATTATCGGCGGTATGGTTCCCGGCTATTCCTGTGACAGTGCCGCCACGCCGTTTATTC
CCTATTTCGTCAGCGCGCTCGATGCGCTGGCCTGGCGCACCGGCGTGCCGGAATCGGTGTATCCGGAGGC
GTTGATACCCGGCCAGCGCGAAGTGGGCAGCACGCCGTCCGGCAATATGTGGGGCAACGTCTACCCGCGC
AGCGGCTTTGTCACGCAGACCGACGGCTACAAATCAGCTGCGGTGGTGGTGCAGCGCGTGGCCGACATCA
TCACCCGTCAGGGGCAGCTTCACGTCTACAACCCGCTGGTCGGGCAGCGCTCAGCGGGCTACTGGCCACC
GGGAGCGGTCAGCGAAAACAGCGGCTCGAAAAACCATAAGTGGCAGCGCCTTTCACCCCGGCTCTCGCAG
AGCTGTGCGGTGTTTCCCGACGTCGGCGGTCAGATTGCGCAGAACGGCAATTACGCCTGGGCGCTCTGGC
AGCCCTACAGCTGCTGCAAACGTCGCGGTCAGACCTTCCTCTACAGCACGGATTTCTCATAA
 Primer design